Active Recombinant Human MYC, His-tagged
| Cat.No. : | MYC-2522H |
| Product Overview : | Recombinant human myc proto-oncogene protein produced in E.coli is a single non-glycosylated polypeptide with a 8His tag at the C-terminus. It contains 452 (442+10) amino acids having a predicted molecular mass of approximately 50.4kD, but migrates in SDS-PAGE with an apparent molecular mass of 60kD. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | Myc (c-Myc) is a regulator gene that codes for a transcription factor. The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. |
| Form : | 20mM Tris-Cl (pH7.9), 20% Glycerol, 100mM NaCl, 1mM DTT and 0.5mM EDTA |
| Bio-activity : | c-Myc protein is a multi-functional protein involved in cell cycle progression, apoptosis, cellular transformation and transcriptional regulation. Recombinant c-Myc protein is ideal for the studies of protein-protein interactions and other related function assays. |
| AA Sequence : | MASMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCS PSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLV SEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSP SSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPH SPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQ RRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA LEHHHHHHHH |
| Purity : | ≥90%, as determined by SDS-PAGE |
| Usage : | FOR RESEARCH ONLY |
| Storage : | The protein sample can be stored under sterile conditions at 2- 8 centigrade for one month or at -70 centigrade for three months without detectable loss of activity. Avoid repeated freeze-thaw cycles. |
| Gene Name | MYC v-myc avian myelocytomatosis viral oncogene homolog [ Homo sapiens ] |
| Official Symbol | MYC |
| Synonyms | MRTL; MYCC; c-Myc; bHLHe39; myc proto-oncogene protein; avian myelocytomatosis viral oncogene homolog; class E basic helix-loop-helix protein 39; myc-related translation/localization regulatory factor; proto-oncogene c-Myc; transcription factor p64; v-myc myelocytomatosis viral oncogene homolog |
| Gene ID | 4609 |
| mRNA Refseq | NM_002467 |
| Protein Refseq | NP_002458 |
| MIM | 190080 |
| UniProt ID | P01106 |
| Chromosome Location | 8q24.21 |
| Pathway | Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Apoptosis, organism-specific biosystem |
| Function | DNA binding; E-box binding; protein binding |
| ◆ Recombinant Proteins | ||
| MYC-254H | Recombinant Human MYC protein, T7/His-tagged | +Inquiry |
| MYC-2522H | Active Recombinant Human MYC, His-tagged | +Inquiry |
| MYC-152H | Recombinant Human MYC tag protein | +Inquiry |
| MYC-6727HF | Recombinant Full Length Human MYC Protein, GST-tagged | +Inquiry |
| MYC-3317H | Recombinant Human MYC protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MYC-4039HCL | Recombinant Human MYC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYC Products
Required fields are marked with *
My Review for All MYC Products
Required fields are marked with *



