Active Recombinant Human MYC, His-tagged
Cat.No. : | MYC-2522H |
Product Overview : | Recombinant human myc proto-oncogene protein produced in E.coli is a single non-glycosylated polypeptide with a 8His tag at the C-terminus. It contains 452 (442+10) amino acids having a predicted molecular mass of approximately 50.4kD, but migrates in SDS-PAGE with an apparent molecular mass of 60kD. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Myc (c-Myc) is a regulator gene that codes for a transcription factor. The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. |
Form : | 20mM Tris-Cl (pH7.9), 20% Glycerol, 100mM NaCl, 1mM DTT and 0.5mM EDTA |
Bio-activity : | c-Myc protein is a multi-functional protein involved in cell cycle progression, apoptosis, cellular transformation and transcriptional regulation. Recombinant c-Myc protein is ideal for the studies of protein-protein interactions and other related function assays. |
AA Sequence : | MASMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCS PSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLV SEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSP SSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPH SPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQ RRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA LEHHHHHHHH |
Purity : | ≥90%, as determined by SDS-PAGE |
Usage : | FOR RESEARCH ONLY |
Storage : | The protein sample can be stored under sterile conditions at 2- 8 centigrade for one month or at -70 centigrade for three months without detectable loss of activity. Avoid repeated freeze-thaw cycles. |
Gene Name | MYC v-myc avian myelocytomatosis viral oncogene homolog [ Homo sapiens ] |
Official Symbol | MYC |
Synonyms | MRTL; MYCC; c-Myc; bHLHe39; myc proto-oncogene protein; avian myelocytomatosis viral oncogene homolog; class E basic helix-loop-helix protein 39; myc-related translation/localization regulatory factor; proto-oncogene c-Myc; transcription factor p64; v-myc myelocytomatosis viral oncogene homolog |
Gene ID | 4609 |
mRNA Refseq | NM_002467 |
Protein Refseq | NP_002458 |
MIM | 190080 |
UniProt ID | P01106 |
Chromosome Location | 8q24.21 |
Pathway | Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Apoptosis, organism-specific biosystem |
Function | DNA binding; E-box binding; protein binding |
◆ Recombinant Proteins | ||
MYC-39H | Recombinant Human MYC, Arg-tagged | +Inquiry |
MYC-2735R | Recombinant Rhesus Macaque MYC Protein, His (Fc)-Avi-tagged | +Inquiry |
MYC-1461H | Recombinant Human MYC Protein, His (Fc)-Avi-tagged | +Inquiry |
MYC-1029H | Recombinant Full Length Human MYC, His-tagged | +Inquiry |
MYC-38H | Recombinant Human MYC, His-tagged | +Inquiry |
◆ Native Proteins | ||
MYC-05H | Recombinant Human MYC Protein, Biotin labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYC-4039HCL | Recombinant Human MYC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYC Products
Required fields are marked with *
My Review for All MYC Products
Required fields are marked with *
0
Inquiry Basket