Active Recombinant Human NCR3LG1, Fc-tagged, Biotinylated
| Cat.No. : | NCR3LG1-547H |
| Product Overview : | The recombinant human B7-H6-Fc fusion is expressed as a 466 amino acid protein consisting of Asp25 - Ser262 region of B7-H6 (UniProt accession #Q68D85) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Human Cells |
| Tag : | Fc |
| Protein Length : | 25-262 a.a. |
| Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
| Bio-activity : | Binds to its receptor NKp30/NCR3 and Induces IFN-γ secretion by NK-92 human natural killer lymphoma cells with an ED50 of 0.4 - 2.6 μg/ml. |
| Molecular Mass : | Calculated molecular mass 52.2 kDa; estimated by SDS-PAGE under reducing condition 75-85 kDa probably due to glycosylation |
| AA Sequence : | DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPW RLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEA INITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLT AARHSLSETEKTDNFSSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL PPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC SVMHEALHNHYTQKSLSLSPGK |
| Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
| Purity : | >95% judged by SDS-PAGE under reducing condition |
| Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
| Conjugation : | Biotin |
| Gene Name | NCR3LG1 natural killer cell cytotoxicity receptor 3 ligand 1 [ Homo sapiens ] |
| Official Symbol | NCR3LG1 |
| Synonyms | B7H6; B7-H6; DKFZp686O24166; DKFZp686I21167; natural cytotoxicity triggering receptor 3 ligand 1; B7 homolog 6; putative Ig-like domain-containing protein DKFZp686O24166/DKFZp686I21167 |
| Gene ID | 374383 |
| mRNA Refseq | NM_001202439 |
| Protein Refseq | NP_001189368 |
| MIM | 613714 |
| UniProt ID | Q68D85 |
| Chromosome Location | 11p15.1 |
| Function | structural molecule activity |
| ◆ Recombinant Proteins | ||
| NCR3LG1-785H | Recombinant Human NCR3LG1 protein, His-tagged | +Inquiry |
| NCR3LG1-500C | Active Recombinant Cynomolgus NCR3LG1 Protein, Fc-tagged | +Inquiry |
| NCR3LG1-205H | Recombinant Human NCR3LG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NCR3LG1-2943H | Recombinant Human NCR3LG1 protein(Asp25-Ser262), His-tagged | +Inquiry |
| NCR3LG1-1290H | Recombinant Human NCR3LG1 protein, Avi & His-tagged, Biotinylated | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NCR3LG1 Products
Required fields are marked with *
My Review for All NCR3LG1 Products
Required fields are marked with *
