Active Recombinant Human NCR3LG1, Fc-tagged, Biotinylated

Cat.No. : NCR3LG1-547H
Product Overview : The recombinant human B7-H6-Fc fusion is expressed as a 466 amino acid protein consisting of Asp25 - Ser262 region of B7-H6 (UniProt accession #Q68D85) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Fc
Protein Length : 25-262 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Binds to its receptor NKp30/NCR3 and Induces IFN-γ secretion by NK-92 human natural killer lymphoma cells with an ED50 of 0.4 - 2.6 μg/ml.
Molecular Mass : Calculated molecular mass 52.2 kDa; estimated by SDS-PAGE under reducing condition 75-85 kDa probably due to glycosylation
AA Sequence : DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPW RLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEA INITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLT AARHSLSETEKTDNFSSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL PPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC SVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name NCR3LG1 natural killer cell cytotoxicity receptor 3 ligand 1 [ Homo sapiens ]
Official Symbol NCR3LG1
Synonyms B7H6; B7-H6; DKFZp686O24166; DKFZp686I21167; natural cytotoxicity triggering receptor 3 ligand 1; B7 homolog 6; putative Ig-like domain-containing protein DKFZp686O24166/DKFZp686I21167
Gene ID 374383
mRNA Refseq NM_001202439
Protein Refseq NP_001189368
MIM 613714
UniProt ID Q68D85
Chromosome Location 11p15.1
Function structural molecule activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NCR3LG1 Products

Required fields are marked with *

My Review for All NCR3LG1 Products

Required fields are marked with *

0
cart-icon