Active Recombinant Human OSM, Fc-tagged, Biotinylated
| Cat.No. : | OSM-657H |
| Product Overview : | The recombinant human OSM-Fc is expressed as a 433-amino acid active form consisting of Ala26 - Arg220 region of (UniProt accession #P13725) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Human Cells |
| Tag : | Fc |
| Protein Length : | 26-220 a.a. |
| Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
| Bio-activity : | Stimulates TF-1 human erythroleukemic cell proliferation assay with an ED50 typically 0.2 - 0.5 ng/ml. Supports the maintenance of embryonic stem (ES) cell pluripotency and germline competency. |
| Molecular Mass : | Calculated molecular mass (kDa): 48.7; Estimated by SDS-PAGE under reducing condition (kDa): ~55 |
| AA Sequence : | AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLN ATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQ PPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRSTTENLYFQGSTGTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQ DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNG QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
| Purity : | >95% judged by SDS-PAGE under reducing condition |
| Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
| Conjugation : | Biotin |
| Gene Name | OSM oncostatin M [ Homo sapiens ] |
| Official Symbol | OSM |
| Synonyms | OSM; oncostatin M; oncostatin-M; MGC20461; |
| Gene ID | 5008 |
| mRNA Refseq | NM_020530 |
| Protein Refseq | NP_065391 |
| MIM | 165095 |
| UniProt ID | P13725 |
| Chromosome Location | 22q12.2 |
| Pathway | Adipogenesis, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; |
| Function | cytokine activity; growth factor activity; oncostatin-M receptor binding; |
| ◆ Recombinant Proteins | ||
| OSM-259H | Recombinant Human OSM, StrepII-tagged | +Inquiry |
| OSM-206H | Recombinant Human OSM, His-tagged | +Inquiry |
| OSM-563R | Recombinant Rhesus macaque OSM protein, His-tagged | +Inquiry |
| OSM-322O | Active Recombinant Human OSM Protein (210 aa) | +Inquiry |
| OSM-307H | Active Recombinant Human OSM Protein | +Inquiry |
| ◆ Native Proteins | ||
| Osm-3256R | Recombinant Rhesus Monkey OSM Protein, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| OSM-1766HCL | Recombinant Human OSM cell lysate | +Inquiry |
| OSM-1659MCL | Recombinant Mouse OSM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OSM Products
Required fields are marked with *
My Review for All OSM Products
Required fields are marked with *
