Active Recombinant Human OSM Protein (210 aa)

Cat.No. : OSM-322O
Product Overview : Recombinant human Oncostatin M(209 a.a.) (rhOSM) produced in E. coli is a single non-glycosylated polypeptide chain containing 210 amino acids. A fully biologically active molecule, rhOSM has a molecular mass of 23.8 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 210
Description : Oncostatin M (OSM) is a multifunctional cytokine, and belongs to Interleukin-6 (IL-6) subfamily, which also includes IL-11, leukemia inhibitory factor (LIF), ciliary neurotropic factor, cardiotrophin-1, and novel neurotropin-1. In vivo, OSM is secreted from activated T cells, monocytes, neutrophils, and endothelial cells. OSM is related to LIF, and shares a receptor with LIF in human. Human OSM can bind to gp130 and recruit OSM Receptor β or LIF Receptor β to form a ternary complex. OSM stimulates the growth of different types of cells, including megakaryocytes, fibroblasts, vascular endothelial cells, and T cells. OSM inhibits the proliferation of several cancer cell lines, such as solid tissue tumor cells, lung cancer cells, melanoma cells, and breast cancer cells.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 10 ng/mL, measured by a cell proliferation assay using TF-1 cells, corresponding to a specific activity of > 1 × 10^5 units/mg.
Molecular Mass : 23.8 kDa, observed by reducing SDS-PAGE.
AA Sequence : MAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRR
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant human Oncostatin M(209 a.a.) (rhOSM) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhOSM should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name OSM oncostatin M [ Homo sapiens ]
Official Symbol OSM
Synonyms OSM; oncostatin M; oncostatin-M; MGC20461;
Gene ID 5008
mRNA Refseq NM_020530
Protein Refseq NP_065391
MIM 165095
UniProt ID P13725

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OSM Products

Required fields are marked with *

My Review for All OSM Products

Required fields are marked with *

0

Inquiry Basket

cartIcon