Active Recombinant Human PAK1

• Cat.No.: PAK1-17H
• Product Overview: PAK1KD is a recombinant wild type human PAK1 kinase domain (amino acids 248–545 of full-length human PAK1) expressed in E. coli and purified to near homogeneity. PAK1KD does not have the inhibitory switch domain and has high specific activity.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: Human PAK1 kinase (UniProt: Q13153; NCBI: NM_002576) belongs to a family of p21-activated kinases. These serine/threonine kinases serve as targets for the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK1 kinase regulates cell motility and morphology.
• Form: 1 mg/ml in Storage Buffer of 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT.
• Bio-activity: 32,638 pmoles/min/μg
• Molecular Mass: The calculated mass is 33,646. PAK1KD is fully phosphorylated at T423 and partially phosphorylated at additional sites with measured mass of 33,728 (1P), 33,808 (2P), 33,889 (3P), and 33,968 (4P).
• AA Sequence: GPHPSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVM RENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSD NILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNE NPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEAT KNNH
• Applications: Enzymatic studies, inhibitor screen, and selectivity profiling
• Storage: Stable at -70oC for 12 months from date of receipt. Protein should be thawed on ice. Protein can be flash-frozen in liquid nitrogen and stored at -70oC.

Gene Information

• Gene Name: PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 [ Homo sapiens ]
• Official Symbol: PAK1
• Synonyms: PAK1; p21 protein (Cdc42/Rac)-activated kinase 1; p21/Cdc42/Rac1 activated kinase 1 (STE20 homolog, yeast) , p21/Cdc42/Rac1 activated kinase 1 (yeast Ste20 related); serine/threonine-protein kinase PAK 1; STE20 homolog; yeast; p65-PAK; alpha-PAK; STE20 homolog, yeast; p21/Cdc42/Rac1-activated kinase 1 (yeast Ste20-related); p21/Cdc42/Rac1-activated kinase 1 (STE20 homolog, yeast); PAKalpha; MGC130000; MGC130001
• Gene ID: 5058
• mRNA Refseq: NM_001128620
• Protein Refseq: NP_001122092
• MIM: 602590
• UniProt ID: Q13153
• Chromosome Location: 11q13-q14
• Pathway: Activation of Rac, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; Aurora A signaling, organism-specific biosystem; Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem
• Function: ATP binding; collagen binding; nucleotide binding; protein binding; contributes_to protein binding; protein kinase activity; protein serine/threonine kinase activity