Active Recombinant Human PDGF-AB Protein
| Cat.No. : | PDGFA-222H |
| Product Overview : | Recombinant Human PDGF-AB Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Description : | Platelet-derived growth factor (PDGF) is an important regulator of cell growth, proliferation, and angiogenesis. PDGF synthesis is induced by IL-1, IL-6, TNF-α, TGF-β and EGF signaling. PDGF functions as a mitogenic growth hormone on cells of mesenchymal lineage, such as smooth muscle and glial cells. PDGF is also stored in the alpha-granules of platelets and is released upon adherence to traumatized tissues. PDGF is a dimeric glycoprotein formed by two A chains (AA), two B chains (BB), or as a heterodimer with an A and a B chain (AB). The PDGF dimer binds the cell surface receptor tyrosine kinases PDGFR-α and PDGFR-β. |
| Bio-activity : | 3T3 cell proliferation, ≤20 ng/mL; ≥5.0 x 10^4 units/mg |
| Molecular Mass : | Dimer, Alpha: 14.4 kDa, Beta: 12.4 kDa, Total 26.8 kDa (Alpha: 126, Beta: 110, Total: 236 aa) |
| AA Sequence : | Alpha chain: MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT Beta chain: MSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT |
| Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
| Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
| Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
| Storage : | Storage Prior to Reconstitution: -20 centigrade |
| Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
| Reconstitution : | Sterile water at 0.1 mg/mL |
| Shipping : | Room temperature |
| Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
| Gene Name | PDGFA platelet-derived growth factor alpha polypeptide [ Homo sapiens (human) ] |
| Official Symbol | PDGFA |
| Synonyms | PDGFA; platelet-derived growth factor alpha polypeptide; platelet-derived growth factor subunit A; PDGF A chain; PDGF A; PDGF1; platelet derived growth factor alpha chain; PDGF-1; PDGF A-chain; PDGF subunit A; platelet-derived growth factor A chain; platelet-derived growth factor alpha chain; platelet-derived growth factor alpha isoform 2 preproprotein; PDGF-A; |
| Gene ID | 5154 |
| mRNA Refseq | NM_002607 |
| Protein Refseq | NP_002598 |
| MIM | 173430 |
| UniProt ID | P04085 |
| ◆ Recombinant Proteins | ||
| Pdgfa-1930R | Recombinant Rat Pdgfa Protein, His-tagged | +Inquiry |
| PDGFA-1044C | Active Recombinant Canine PDGFA protein(Ser87-Arg196), hFc-tagged | +Inquiry |
| PDGFA-6594M | Recombinant Mouse PDGFA Protein, His (Fc)-Avi-tagged | +Inquiry |
| PDGFA-1392H | Recombinant Human PDGFA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Pdgfa-304M | Active Recombinant Mouse Pdgfa | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDGFA-3337HCL | Recombinant Human PDGFA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDGFA Products
Required fields are marked with *
My Review for All PDGFA Products
Required fields are marked with *
