Active Recombinant Human Pepsinogen I Protein
Cat.No. : | PGC-1028H |
Product Overview : | Recombinant Human pepsinogen I protein. Predicted molecular weight: 40 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | Pepsinogen is the pro-form of pepsin and is produced in the stomach by chief cells. The major part of pepsinogen is secreted into the gastric lumen but a small amount can be found in the blood. Alterations in the serum pepsinogen concentrations has been found with Helicobacter pylori (H. Pylori) infections, peptic ulcer disease, gastritis, and gastric cancer. More precise analysis may be achieved by measuring the pepsinogen I/II ratio. |
Form : | Lyophilized from 0.2 μm filtered solution |
Bio-activity : | Anti- h Pepsinogen I 8003 : + Anti- h Pepsinogen I 8015 : + |
Molecular Mass : | 40 kDa |
AA Sequence : | MIMYKVPLIRKKSLRRTLSERGLLKDFLKKHNLNPARKYFPQWEAPTLVDEQPLENYLDMEYFGTIGI GTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSETVSITYGTGSMTGILGYD TVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLS ADDQSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGEAIACAEGCQAIVDTGTSLLTG PTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCISGFQGMNLPT ESGELWILGDVFIRQYFTVFDRANNQVGLAPVA |
Storage : | 2–8centigrade |
Concentration : | 0.5 mg/ml when reconstituted with 200 µl of deionized water |
Storage Buffer : | 50 mM Tris-HCl, pH 7.5; 150 mM NaCl, 0,5 µg/ml pepstatin A; containing 6 % sucrose as a stabilizer |
Reconstitution : | Reconstitute lyophilized protein with 200 µl of deionized water |
Gene Name | PGC progastricsin (pepsinogen C) [ Homo sapiens ] |
Official Symbol | PGC |
Synonyms | PGC; progastricsin (pepsinogen C); gastricsin; pepsin C; pepsinogen C; preprogastricsin; pepsinogen group II; PEPC; PGII; FLJ99563; |
Gene ID | 5225 |
mRNA Refseq | NM_001166424 |
Protein Refseq | NP_001159896 |
MIM | 169740 |
UniProt ID | P20142 |
◆ Recombinant Proteins | ||
PGC-6440C | Recombinant Chicken PGC | +Inquiry |
Pgc-2538R | Recombinant Rat Pgc protein, His-tagged | +Inquiry |
PGC-1315H | Recombinant Human PGC Protein, MYC/DDK-tagged | +Inquiry |
PGC-6662M | Recombinant Mouse PGC Protein, His (Fc)-Avi-tagged | +Inquiry |
PGC-0041H | Recombinant Human PGC Protein | +Inquiry |
◆ Native Proteins | ||
PGC-132H | Native Human Pepsinogen II | +Inquiry |
PGC-8318H | Native Human PGC | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGC-2169HCL | Recombinant Human PGC cell lysate | +Inquiry |
PGC-1705RCL | Recombinant Rat PGC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PGC Products
Required fields are marked with *
My Review for All PGC Products
Required fields are marked with *