Active Recombinant Human PSPN Protein

Cat.No. : PSPN-231H
Product Overview : Recombinant Human PSPN Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Persephin is a neurotrophic factor of the glial cell line-derived neurotrophic factor (GDNF) family. Persephin promotes survival and growth of dopaminergic and motor neurons, but not peripheral neurons. Persephin is a ligand for the RET receptor tyrosine kinase.
Bio-activity : TT cell proliferation, ≤20 ng/mL
Molecular Mass : Dimer, 10.4/20.8 kDa (97/194 aa)
AA Sequence : MALSGPCQLWSLTLSVAELGLGYASEEKVIFRYCAGSCPRGARTQHGLALARLQGQGRAHGGPCCRPTRYTDVAFLDDRHRWQRLPQLSAAACGCGG
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name PSPN persephin [ Homo sapiens (human) ]
Official Symbol PSPN
Synonyms PSPN; persephin; PSP;
Gene ID 5623
mRNA Refseq NM_004158
Protein Refseq NP_004149
MIM 602921
UniProt ID O60542

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PSPN Products

Required fields are marked with *

My Review for All PSPN Products

Required fields are marked with *

0
cart-icon
0
compare icon