Active Recombinant Human PSPN Protein
Cat.No. : | PSPN-231H |
Product Overview : | Recombinant Human PSPN Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Persephin is a neurotrophic factor of the glial cell line-derived neurotrophic factor (GDNF) family. Persephin promotes survival and growth of dopaminergic and motor neurons, but not peripheral neurons. Persephin is a ligand for the RET receptor tyrosine kinase. |
Bio-activity : | TT cell proliferation, ≤20 ng/mL |
Molecular Mass : | Dimer, 10.4/20.8 kDa (97/194 aa) |
AA Sequence : | MALSGPCQLWSLTLSVAELGLGYASEEKVIFRYCAGSCPRGARTQHGLALARLQGQGRAHGGPCCRPTRYTDVAFLDDRHRWQRLPQLSAAACGCGG |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | PSPN persephin [ Homo sapiens (human) ] |
Official Symbol | PSPN |
Synonyms | PSPN; persephin; PSP; |
Gene ID | 5623 |
mRNA Refseq | NM_004158 |
Protein Refseq | NP_004149 |
MIM | 602921 |
UniProt ID | O60542 |
◆ Recombinant Proteins | ||
PSPN-001H | Recombinant Human PSPN Protein, His tagged | +Inquiry |
PSPN-1003H | Active Recombinant Human PSPN | +Inquiry |
PSPN-4793R | Recombinant Rat PSPN Protein | +Inquiry |
Pspn-5209M | Active Recombinant Mouse Pspn Protein | +Inquiry |
PSPN-231H | Active Recombinant Human PSPN Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSPN-2733HCL | Recombinant Human PSPN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSPN Products
Required fields are marked with *
My Review for All PSPN Products
Required fields are marked with *