Recombinant Mouse Pspn protein
Cat.No. : | Pspn-21M |
Product Overview : | Recombinant Mouse Pspn protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 96 |
Description : | This gene encodes a secreted ligand of the GDNF (glial cell line-derived neurotrophic factor) subfamily and TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein signals through the RET receptor tyrosine kinase and a GPI-linked coreceptor, and promotes survival of neuronal populations. This protein may play a role in cell death, and nervous system development and function. Elevated expression of this gene has been observed in oral squamous cell carcinoma. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 30 % ACN, 0.1 % TFA, 150 mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TT medullary thyroid cancer cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 × 10⁷ IU/mg. |
Molecular Mass : | Approximately 20.7 kDa, a disulfide-linked homodimer of two 96 amino acid polypeptide chains. |
AA Sequence : | ALAGSCRLWSLTLPVAELGLGYASEEKVIFRYCAGSCPQEARTQHSLVLARLRGRGRAHGRPCCQPTSYADVTFLDDQHHWQQLPQLSAAACGCGG |
Endotoxin : | Less than 0.1 EU/µg of rMuPersephin as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Pspn |
Official Symbol | Pspn |
Synonyms | PSPN; persephin; PSP; |
Gene ID | 19197 |
mRNA Refseq | NM_008954 |
Protein Refseq | NP_032980 |
UniProt ID | O70300 |
◆ Recombinant Proteins | ||
Pspn-5209M | Active Recombinant Mouse Pspn Protein | +Inquiry |
PSPN-001H | Recombinant Human PSPN Protein, His tagged | +Inquiry |
PSPN-361H | Recombinant Human PSPN Protein, His/GST-tagged | +Inquiry |
Pspn-21M | Recombinant Mouse Pspn protein | +Inquiry |
PSPN-098H | Active Recombinant Human PSPN Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSPN-2733HCL | Recombinant Human PSPN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Pspn Products
Required fields are marked with *
My Review for All Pspn Products
Required fields are marked with *
0
Inquiry Basket