Species : |
Mouse |
Source : |
E.coli |
Description : |
This gene encodes a secreted ligand of the GDNF (glial cell line-derived neurotrophic factor) subfamily and TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein signals through the RET receptor tyrosine kinase and a GPI-linked coreceptor, and promotes survival of neuronal populations. This protein may play a role in cell death, and nervous system development and function. Mice lacking a functional copy of this gene exhibit hypersensitivity to cerebral ischemia. |
Bio-activity : |
ED50 was determined by its ability to stimulate proliferation of human thyroid carcinoma cells (TT cells) is > 0.1 ng/mL, corresponding to a specific activity of > 1 × 10^7 units/mg. |
Molecular Mass : |
10.3 kDa |
AA Sequence : |
ALAGSCRLWSLTLPVAELGLGYASEEKVIFRYCAGSCPQEARTQHSLVLARLRGRGRAHGRPCCQPTSYADVTFLDDQHHWQQLPQLSAAACGCGG |
Endotoxin : |
< 0.1 ng/μg of protein (< 1 EU/μg) |
Purity : |
> 95% as determined by SDS-PAGE and Coomassie blue staining |
Stability : |
Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : |
Store at -80 centigrade. |
Storage Buffer : |
LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2 |