Active Recombinant Mouse Pspn Protein
Cat.No. : | Pspn-5209M |
Product Overview : | Purified recombinant protein of Mouse persephin (Pspn) without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | This gene encodes a secreted ligand of the GDNF (glial cell line-derived neurotrophic factor) subfamily and TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein signals through the RET receptor tyrosine kinase and a GPI-linked coreceptor, and promotes survival of neuronal populations. This protein may play a role in cell death, and nervous system development and function. Mice lacking a functional copy of this gene exhibit hypersensitivity to cerebral ischemia. |
Bio-activity : | ED50 was determined by its ability to stimulate proliferation of human thyroid carcinoma cells (TT cells) is > 0.1 ng/mL, corresponding to a specific activity of > 1 × 10^7 units/mg. |
Molecular Mass : | 10.3 kDa |
AA Sequence : | ALAGSCRLWSLTLPVAELGLGYASEEKVIFRYCAGSCPQEARTQHSLVLARLRGRGRAHGRPCCQPTSYADVTFLDDQHHWQQLPQLSAAACGCGG |
Endotoxin : | < 0.1 ng/μg of protein (< 1 EU/μg) |
Purity : | > 95% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2 |
Gene Name | Pspn persephin [ Mus musculus (house mouse) ] |
Official Symbol | Pspn |
Synonyms | PSPN; persephin; PSP |
Gene ID | 19197 |
mRNA Refseq | NM_008954 |
Protein Refseq | NP_032980 |
UniProt ID | A1L3Q1 |
◆ Recombinant Proteins | ||
PSPN-361H | Recombinant Human PSPN Protein, His/GST-tagged | +Inquiry |
PSPN-6006H | Recombinant Human PSPN Protein (Ala61-Gly156), N-His tagged | +Inquiry |
Pspn-5209M | Active Recombinant Mouse Pspn Protein | +Inquiry |
PSPN-570H | Recombinant Human PSPN protein | +Inquiry |
PSPN-231H | Active Recombinant Human PSPN Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSPN-2733HCL | Recombinant Human PSPN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Pspn Products
Required fields are marked with *
My Review for All Pspn Products
Required fields are marked with *
0
Inquiry Basket