Active Recombinant Mouse Pspn Protein

Cat.No. : Pspn-5209M
Product Overview : Purified recombinant protein of Mouse persephin (Pspn) without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : This gene encodes a secreted ligand of the GDNF (glial cell line-derived neurotrophic factor) subfamily and TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein signals through the RET receptor tyrosine kinase and a GPI-linked coreceptor, and promotes survival of neuronal populations. This protein may play a role in cell death, and nervous system development and function. Mice lacking a functional copy of this gene exhibit hypersensitivity to cerebral ischemia.
Bio-activity : ED50 was determined by its ability to stimulate proliferation of human thyroid carcinoma cells (TT cells) is > 0.1 ng/mL, corresponding to a specific activity of > 1 × 10^7 units/mg.
Molecular Mass : 10.3 kDa
AA Sequence : ALAGSCRLWSLTLPVAELGLGYASEEKVIFRYCAGSCPQEARTQHSLVLARLRGRGRAHGRPCCQPTSYADVTFLDDQHHWQQLPQLSAAACGCGG
Endotoxin : < 0.1 ng/μg of protein (< 1 EU/μg)
Purity : > 95% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2
Gene Name Pspn persephin [ Mus musculus (house mouse) ]
Official Symbol Pspn
Synonyms PSPN; persephin; PSP
Gene ID 19197
mRNA Refseq NM_008954
Protein Refseq NP_032980
UniProt ID A1L3Q1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Pspn Products

Required fields are marked with *

My Review for All Pspn Products

Required fields are marked with *

0
cart-icon