Active Recombinant Human RAET1L Protein, His-tagged

Cat.No. : RAET1L-02H
Product Overview : Recombinant human RAET1L (26-218aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 26-218aa
Description : RAET1L belongs to the RAET1 family of major histocompatibility complex (MHC) class I-related genes, which are located within a 180-kb cluster on chromosome 6q24.2-q25.3. The REAT1 genes encode glycoproteins that contain extracellular alpha-1 and alpha-2 domains, but they lack the membrane proximal Ig-like alpha-3 domain. Most RAET1 glycoproteins are anchored to the membrane via glycosylphosphatidylinositol (GPI) linkage.
Form : Liquid
Bio-activity : Measured by its binding ability in a functional ELISA with Human NKG2D.
Molecular Mass : 22.9kDa (202aa)
AA Sequence : RRDDPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTMAWKAQNPVLREVVDILTEQLLDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSIDGQTFLLFDSEKRMWTTVHPGARKMKEKWENDKDVAMSFHYISMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSG
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name RAET1L retinoic acid early transcript 1L [ Homo sapiens (human) ]
Official Symbol RAET1L
Synonyms RAET1L; retinoic acid early transcript 1L; ULBP6; UL16-binding protein 6; UL16 binding protein 6; retinoic acid early transcript 1L protein
Gene ID 154064
mRNA Refseq NM_130900
Protein Refseq NP_570970
MIM 611047
UniProt ID Q5VY80

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAET1L Products

Required fields are marked with *

My Review for All RAET1L Products

Required fields are marked with *

0
cart-icon
0
compare icon