Active Recombinant Human RETN Protein, His-tagged
| Cat.No. : | RETN-61H |
| Product Overview : | Recombinant Human RETN protein(Ser17-Pro108), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | February 01, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Ser17-Pro108 |
| Tag : | N-His |
| Form : | Liquid in sterile PBS, pH8.0, 10% Glycerol, 8% Trehalose. |
| Molecular Mass : | The protein has a calculated MW of 11 kDa. |
| Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
| Purity : | > 90 % as determined by SDS-PAGE. |
| Storage : | Store it under sterile conditions at -20 to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1.0 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | MGSSHHHHHHHHHHSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP |
| Gene Name | RETN resistin [ Homo sapiens ] |
| Official Symbol | RETN |
| Synonyms | RETN; resistin; ADSF; FIZZ3; RETN1; resistin delta2; found in inflammatory zone 3; cysteine-rich secreted protein FIZZ3; adipose tissue-specific secretory factor; cysteine-rich secreted protein A12-alpha-like 2; c/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein; C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich protein precursor 1; RSTN; XCP1; MGC126603; MGC126609; |
| Gene ID | 56729 |
| mRNA Refseq | NM_001193374 |
| Protein Refseq | NP_001180303 |
| MIM | 605565 |
| UniProt ID | Q9HD89 |
| ◆ Recombinant Proteins | ||
| RETN-3981H | Recombinant Human RETN Protein, His (Fc)-Avi-tagged | +Inquiry |
| Retn-235M | Recombinant Mouse Retn Protein | +Inquiry |
| RETN-196H | Recombinant Human RETN, Flag-tagged | +Inquiry |
| Retn-68M | Recombinant Mouse Resistin, Flag-tagged | +Inquiry |
| Retn-5272M | Recombinant Mouse Resistin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RETN-1635MCL | Recombinant Mouse RETN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RETN Products
Required fields are marked with *
My Review for All RETN Products
Required fields are marked with *
