Active Recombinant Human RETN Protein, His-tagged

Cat.No. : RETN-61H
Product Overview : Recombinant Human RETN protein(Ser17-Pro108), fused with N-terminal His tag, was expressed in E. coli.
Availability August 23, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Ser17-Pro108
Tag : N-His
Form : Liquid in sterile PBS, pH8.0, 10% Glycerol, 8% Trehalose.
Molecular Mass : The protein has a calculated MW of 11 kDa.
Endotoxin : <1.0EU per 1μg (determined by the LAL method).
Purity : > 90 % as determined by SDS-PAGE.
Storage : Store it under sterile conditions at -20 to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1.0 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : MGSSHHHHHHHHHHSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
Gene Name RETN resistin [ Homo sapiens ]
Official Symbol RETN
Synonyms RETN; resistin; ADSF; FIZZ3; RETN1; resistin delta2; found in inflammatory zone 3; cysteine-rich secreted protein FIZZ3; adipose tissue-specific secretory factor; cysteine-rich secreted protein A12-alpha-like 2; c/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein; C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich protein precursor 1; RSTN; XCP1; MGC126603; MGC126609;
Gene ID 56729
mRNA Refseq NM_001193374
Protein Refseq NP_001180303
MIM 605565
UniProt ID Q9HD89

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RETN Products

Required fields are marked with *

My Review for All RETN Products

Required fields are marked with *

0
cart-icon