Active Recombinant Human RETN Protein, His-tagged
Cat.No. : | RETN-61H |
Product Overview : | Recombinant Human RETN protein(Ser17-Pro108), fused with N-terminal His tag, was expressed in E. coli. |
Availability | May 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Ser17-Pro108 |
Tag : | N-His |
Form : | Liquid in sterile PBS, pH8.0, 10% Glycerol, 8% Trehalose. |
Molecular Mass : | The protein has a calculated MW of 11 kDa. |
Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
Purity : | > 90 % as determined by SDS-PAGE. |
Storage : | Store it under sterile conditions at -20 to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1.0 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | MGSSHHHHHHHHHHSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP |
Gene Name | RETN resistin [ Homo sapiens ] |
Official Symbol | RETN |
Synonyms | RETN; resistin; ADSF; FIZZ3; RETN1; resistin delta2; found in inflammatory zone 3; cysteine-rich secreted protein FIZZ3; adipose tissue-specific secretory factor; cysteine-rich secreted protein A12-alpha-like 2; c/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein; C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich protein precursor 1; RSTN; XCP1; MGC126603; MGC126609; |
Gene ID | 56729 |
mRNA Refseq | NM_001193374 |
Protein Refseq | NP_001180303 |
MIM | 605565 |
UniProt ID | Q9HD89 |
◆ Recombinant Proteins | ||
Retn-69R | Recombinant Rat Resistin, His-tagged | +Inquiry |
RETN-305H | Active Recombinant Human Resistin | +Inquiry |
RETN-70H | Recombinant Human Resistin | +Inquiry |
RETN-6027H | Recombinant Human RETN Protein (Lys19-Pro108), C-Fc tagged | +Inquiry |
Retn-1056R | Recombinant Rat Retn protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RETN-1635MCL | Recombinant Mouse RETN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RETN Products
Required fields are marked with *
My Review for All RETN Products
Required fields are marked with *
0
Inquiry Basket