Recombinant Mouse Retn Protein
Cat.No. : | Retn-235M |
Product Overview : | Recombinant Mouse Retn Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Resistin, also known as FIZZ3, is a peptide hormone belonging to a class of cysteine-rich secreted proteins termed the resistin-like molecules (RELM) family. Mouse resistin, produced by adipocytes, is involved in insulin resistance and modulates glucose homeostasis and adipogenesis. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Dimer, 10.3/20.6 kDa (95/190 aa) |
AA Sequence : | MSSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Retn resistin [ Mus musculus (house mouse) ] |
Official Symbol | Retn |
Synonyms | RETN; resistin; found in inflammatory zone 3; cysteine-rich secreted protein FIZZ3; adipose tissue-specific secretory factor; dominant inhibitory adipocyte-specific secretory factor; adipose-specific cysteine-rich secreted protein A12-alpha; ADSF; Rstn; Xcp4; Fizz3; |
Gene ID | 57264 |
mRNA Refseq | NM_001204959 |
Protein Refseq | NP_001191888 |
UniProt ID | Q5BMX4 |
◆ Recombinant Proteins | ||
RETN-198H | Recombinant Human RETN protein, Fc-tagged | +Inquiry |
RETN-1817HFL | Recombinant Full Length Human RETN Protein, C-Flag-tagged | +Inquiry |
RETN-6027H | Recombinant Human RETN Protein (Lys19-Pro108), C-Fc tagged | +Inquiry |
RETN-63H | Active Recombinant Human RETN | +Inquiry |
Retn-1056R | Recombinant Rat Retn protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RETN-1635MCL | Recombinant Mouse RETN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Retn Products
Required fields are marked with *
My Review for All Retn Products
Required fields are marked with *