Active Recombinant Human RSPO1 Protein, His-tagged
Cat.No. : | RSPO1-2612H |
Product Overview : | Recombinant Human RSPO1 protein(Arg31-Ala263), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | Arg31-Ala263 |
Tag : | C-His |
Form : | Liquid in sterile PBS, pH7.4. |
Molecular Mass : | The protein has a calculated MW of 26 kDa. |
Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
Purity : | > 90 % as determined by SDS-PAGE. |
Storage : | Store it under sterile conditions at -20 to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.81 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | RISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPAHHHHHH |
Gene Name | RSPO1 R-spondin 1 [ Homo sapiens ] |
Official Symbol | RSPO1 |
Synonyms | RSPO1; R-spondin 1; R spondin homolog (Xenopus laevis); R-spondin-1; FLJ40906; RSPONDIN; R-spondin homolog; roof plate-specific spondin-1; RSPO; CRISTIN3; RP11-566C13.1; |
Gene ID | 284654 |
mRNA Refseq | NM_001038633 |
Protein Refseq | NP_001033722 |
MIM | 609595 |
UniProt ID | Q2MKA7 |
◆ Recombinant Proteins | ||
RSPO1-422H | Recombinant Human RSPO1 Protein, His-tagged | +Inquiry |
RSPO1-421H | Recombinant Human RSPO1 Protein, His-tagged | +Inquiry |
RSPO1-0660H | Active Recombinant Human RSPO1 protein, Fc-tagged | +Inquiry |
Rspo1-8672M | Active Recombinant Mouse Rspo1 protein(Met1-Gln265), His-tagged | +Inquiry |
Rspo1-4024M | Recombinant Mouse Rspo1, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RSPO1-001MCL | Recombinant Mouse RSPO1 cell lysate | +Inquiry |
RSPO1-1918HCL | Recombinant Human RSPO1 cell lysate | +Inquiry |
RSPO1-001HCL | Recombinant Human RSPO1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RSPO1 Products
Required fields are marked with *
My Review for All RSPO1 Products
Required fields are marked with *
0
Inquiry Basket