Active Recombinant Human RSPO1 Protein, His-tagged

Cat.No. : RSPO1-2612H
Product Overview : Recombinant Human RSPO1 protein(Arg31-Ala263), fused with C-terminal His tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : Arg31-Ala263
Tag : C-His
Form : Liquid in sterile PBS, pH7.4.
Molecular Mass : The protein has a calculated MW of 26 kDa.
Endotoxin : <1.0EU per 1μg (determined by the LAL method).
Purity : > 90 % as determined by SDS-PAGE.
Storage : Store it under sterile conditions at -20 to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.81 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : RISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPAHHHHHH
Gene Name RSPO1 R-spondin 1 [ Homo sapiens ]
Official Symbol RSPO1
Synonyms RSPO1; R-spondin 1; R spondin homolog (Xenopus laevis); R-spondin-1; FLJ40906; RSPONDIN; R-spondin homolog; roof plate-specific spondin-1; RSPO; CRISTIN3; RP11-566C13.1;
Gene ID 284654
mRNA Refseq NM_001038633
Protein Refseq NP_001033722
MIM 609595
UniProt ID Q2MKA7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RSPO1 Products

Required fields are marked with *

My Review for All RSPO1 Products

Required fields are marked with *

0
cart-icon