Active Recombinant Human SFRP1, Fc-tagged

Cat.No. : SFRP1-673H
Product Overview : The recombinant human sFRP1-Fc is expressed as a 511-amino acid active form consisting of Ser32 - Lys314 region of sFRP1 (UniProt accession #Q8N474) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Fc
Protein Length : 32-314 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Bio-activity : Inhibits the proliferation of HeLa human cervical epithelial carcinoma cells with an ED50 of 0.2 - 0.8 μg/mL
Molecular Mass : Calculated molecular mass (kDa): 58.1; Estimated by SDS-PAGE under reducing condition (kDa): 75-85
AA Sequence : SEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNC HAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASK PQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNG ADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFKSTGTHTCPPCPAP ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
Purity : >90% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name SFRP1 secreted frizzled-related protein 1 [ Homo sapiens ]
Official Symbol SFRP1
Synonyms SFRP1; secreted frizzled-related protein 1; FRP; FRP 1; SARP2; SARP-2; sFRP-1; secreted apoptosis-related protein 2; FRP1; FrzA; FRP-1;
Gene ID 6422
mRNA Refseq NM_003012
Protein Refseq NP_003003
MIM 604156
UniProt ID Q8N474
Chromosome Location 8p11.21
Pathway Validated targets of C-MYC transcriptional repression, organism-specific biosystem; Wnt Signaling Pathway NetPath, organism-specific biosystem; Wnt signaling pathway, organism-specific biosystem; Wnt signaling pathway, conserved biosystem;
Function PDZ domain binding; Wnt-activated receptor activity; Wnt-protein binding; cysteine-type endopeptidase activity; drug binding; frizzled binding; heparin binding; identical protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SFRP1 Products

Required fields are marked with *

My Review for All SFRP1 Products

Required fields are marked with *

0
cart-icon