Active Recombinant Human SFRP1, Fc-tagged
| Cat.No. : | SFRP1-673H |
| Product Overview : | The recombinant human sFRP1-Fc is expressed as a 511-amino acid active form consisting of Ser32 - Lys314 region of sFRP1 (UniProt accession #Q8N474) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Human Cells |
| Tag : | Fc |
| Protein Length : | 32-314 a.a. |
| Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). |
| Bio-activity : | Inhibits the proliferation of HeLa human cervical epithelial carcinoma cells with an ED50 of 0.2 - 0.8 μg/mL |
| Molecular Mass : | Calculated molecular mass (kDa): 58.1; Estimated by SDS-PAGE under reducing condition (kDa): 75-85 |
| AA Sequence : | SEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNC HAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASK PQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNG ADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFKSTGTHTCPPCPAP ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
| Purity : | >90% judged by SDS-PAGE under reducing condition |
| Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
| Gene Name | SFRP1 secreted frizzled-related protein 1 [ Homo sapiens ] |
| Official Symbol | SFRP1 |
| Synonyms | SFRP1; secreted frizzled-related protein 1; FRP; FRP 1; SARP2; SARP-2; sFRP-1; secreted apoptosis-related protein 2; FRP1; FrzA; FRP-1; |
| Gene ID | 6422 |
| mRNA Refseq | NM_003012 |
| Protein Refseq | NP_003003 |
| MIM | 604156 |
| UniProt ID | Q8N474 |
| Chromosome Location | 8p11.21 |
| Pathway | Validated targets of C-MYC transcriptional repression, organism-specific biosystem; Wnt Signaling Pathway NetPath, organism-specific biosystem; Wnt signaling pathway, organism-specific biosystem; Wnt signaling pathway, conserved biosystem; |
| Function | PDZ domain binding; Wnt-activated receptor activity; Wnt-protein binding; cysteine-type endopeptidase activity; drug binding; frizzled binding; heparin binding; identical protein binding; |
| ◆ Recombinant Proteins | ||
| SFRP1-859H | Recombinant Human SFRP1, His tagged | +Inquiry |
| SFRP1-364H | Recombinant Human SFRP1 Protein, His-tagged | +Inquiry |
| SFRP1-790M | Recombinant Mouse SFRP1 protein(Met1-Lys314), His-tagged | +Inquiry |
| Sfrp1-861R | Recombinant Rat Sfrp1, Fc tagged | +Inquiry |
| SFRP1-221H | Active Recombinant Human SFRP1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SFRP1-2853HCL | Recombinant Human SFRP1 cell lysate | +Inquiry |
| SFRP1-2852MCL | Recombinant Mouse SFRP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SFRP1 Products
Required fields are marked with *
My Review for All SFRP1 Products
Required fields are marked with *
