Active Recombinant Human SFRP1, Fc-tagged, Biotinylated
Cat.No. : | SFRP1-672H |
Product Overview : | The recombinant human sFRP1-Fc is expressed as a 511-amino acid active form consisting of Ser32 - Lys314 region of sFRP1 (UniProt accession #Q8N474) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 32-314 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Inhibits the proliferation of HeLa human cervical epithelial carcinoma cells with an ED50 of 0.2 - 0.8 μg/mL |
Molecular Mass : | Calculated molecular mass (kDa): 58.1; Estimated by SDS-PAGE under reducing condition (kDa): 75-85 |
AA Sequence : | SEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNC HAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASK PQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNG ADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFKSTGTHTCPPCPAP ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >90% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Conjugation : | Biotin |
Gene Name | SFRP1 secreted frizzled-related protein 1 [ Homo sapiens ] |
Official Symbol | SFRP1 |
Synonyms | SFRP1; secreted frizzled-related protein 1; FRP; FRP 1; SARP2; SARP-2; sFRP-1; secreted apoptosis-related protein 2; FRP1; FrzA; FRP-1; |
Gene ID | 6422 |
mRNA Refseq | NM_003012 |
Protein Refseq | NP_003003 |
MIM | 604156 |
UniProt ID | Q8N474 |
Chromosome Location | 8p11.21 |
Pathway | Validated targets of C-MYC transcriptional repression, organism-specific biosystem; Wnt Signaling Pathway NetPath, organism-specific biosystem; Wnt signaling pathway, organism-specific biosystem; Wnt signaling pathway, conserved biosystem; |
Function | PDZ domain binding; Wnt-activated receptor activity; Wnt-protein binding; cysteine-type endopeptidase activity; drug binding; frizzled binding; heparin binding; identical protein binding; |
◆ Recombinant Proteins | ||
SFRP1-8311H | Recombinant Human SFRP1 | +Inquiry |
SFRP1-364H | Recombinant Human SFRP1 Protein, His-tagged | +Inquiry |
Sfrp1-861R | Recombinant Rat Sfrp1, Fc tagged | +Inquiry |
SFRP1-3990R | Recombinant Rhesus Macaque SFRP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SFRP1-4049H | Recombinant Human SFRP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SFRP1-2853HCL | Recombinant Human SFRP1 cell lysate | +Inquiry |
SFRP1-2852MCL | Recombinant Mouse SFRP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SFRP1 Products
Required fields are marked with *
My Review for All SFRP1 Products
Required fields are marked with *