Active Recombinant Human SFRP1, Fc-tagged, Biotinylated

• Cat.No.: SFRP1-672H
• Product Overview: The recombinant human sFRP1-Fc is expressed as a 511-amino acid active form consisting of Ser32 - Lys314 region of sFRP1 (UniProt accession #Q8N474) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

Specification

• Species: Human
• Source: Human Cells
• Tag: Fc
• Protein Length: 32-314 a.a.
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
• Bio-activity: Inhibits the proliferation of HeLa human cervical epithelial carcinoma cells with an ED50 of 0.2 - 0.8 μg/mL
• Molecular Mass: Calculated molecular mass (kDa): 58.1; Estimated by SDS-PAGE under reducing condition (kDa): 75-85
• AA Sequence: SEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNC HAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASK PQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNG ADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFKSTGTHTCPPCPAP ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
• Purity: >90% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
• Conjugation: Biotin

Gene Information

• Gene Name: SFRP1 secreted frizzled-related protein 1 [ Homo sapiens ]
• Official Symbol: SFRP1
• Synonyms: SFRP1; secreted frizzled-related protein 1; FRP; FRP 1; SARP2; SARP-2; sFRP-1; secreted apoptosis-related protein 2; FRP1; FrzA; FRP-1
• Gene ID: 6422
• mRNA Refseq: NM_003012
• Protein Refseq: NP_003003
• MIM: 604156
• UniProt ID: Q8N474
• Chromosome Location: 8p11.21
• Pathway: Validated targets of C-MYC transcriptional repression, organism-specific biosystem; Wnt Signaling Pathway NetPath, organism-specific biosystem; Wnt signaling pathway, organism-specific biosystem; Wnt signaling pathway, conserved biosystem
• Function: PDZ domain binding; Wnt-activated receptor activity; Wnt-protein binding; cysteine-type endopeptidase activity; drug binding; frizzled binding; heparin binding; identical protein binding