Active Recombinant Human TDGF1 protein, T7/His-tagged
| Cat.No. : | TDGF1-78H |
| Product Overview : | Recombinant human Cripto-1 cDNA (31-150aa, isoform-1, derived from BC067844) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 31-150 a.a. |
| Form : | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Bio-activity : | Measured by its binding ability in a functional ELSA. Immobilized recombinant human Nodal protein at 2ug/ml (100ul/well) can bind rhCripto-1 with a linear range of 0.5-100 ng/ml. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFLGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSK ELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCD |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used for in vitro Cripto-1/Nodal signaling pathway regulations study for mesoderm differentiation.2. Potential biomarker protein for various cancer diagnostic developments.3. May be used as antigen for specific antibody production. |
| Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
| Gene Name | TDGF1 teratocarcinoma-derived growth factor 1 [ Homo sapiens ] |
| Official Symbol | TDGF1 |
| Synonyms | TDGF1; teratocarcinoma-derived growth factor 1; CR; CRIPTO; Cripto 1; cripto-1 growth factor; epidermal growth factor-like cripto protein CR1; CRGF; |
| Gene ID | 6997 |
| mRNA Refseq | NM_001174136 |
| Protein Refseq | NP_001167607 |
| MIM | |
| UniProt ID | P13385 |
| Chromosome Location | 3p21.31 |
| Pathway | Developmental Biology, organism-specific biosystem; Glypican 1 network, organism-specific biosystem; Regulation of Signaling by NODAL, organism-specific biosystem; Signaling by NODAL, organism-specific biosystem; |
| Function | growth factor activity; protein binding; receptor binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TDGF1 Products
Required fields are marked with *
My Review for All TDGF1 Products
Required fields are marked with *



