Active Recombinant Human TDGF1 protein, T7/His-tagged
Cat.No. : | TDGF1-78H |
Product Overview : | Recombinant human Cripto-1 cDNA (31-150aa, isoform-1, derived from BC067844) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 31-150 a.a. |
Form : | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
Bio-activity : | Measured by its binding ability in a functional ELSA. Immobilized recombinant human Nodal protein at 2ug/ml (100ul/well) can bind rhCripto-1 with a linear range of 0.5-100 ng/ml. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFLGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSK ELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCD |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro Cripto-1/Nodal signaling pathway regulations study for mesoderm differentiation.2. Potential biomarker protein for various cancer diagnostic developments.3. May be used as antigen for specific antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | TDGF1 teratocarcinoma-derived growth factor 1 [ Homo sapiens ] |
Official Symbol | TDGF1 |
Synonyms | TDGF1; teratocarcinoma-derived growth factor 1; CR; CRIPTO; Cripto 1; cripto-1 growth factor; epidermal growth factor-like cripto protein CR1; CRGF; |
Gene ID | 6997 |
mRNA Refseq | NM_001174136 |
Protein Refseq | NP_001167607 |
MIM | |
UniProt ID | P13385 |
Chromosome Location | 3p21.31 |
Pathway | Developmental Biology, organism-specific biosystem; Glypican 1 network, organism-specific biosystem; Regulation of Signaling by NODAL, organism-specific biosystem; Signaling by NODAL, organism-specific biosystem; |
Function | growth factor activity; protein binding; receptor binding; |
◆ Recombinant Proteins | ||
TDGF1-1254R | Recombinant Rat TDGF1 protein(Met1-Cys143), His-tagged | +Inquiry |
TDGF1-27821TH | Active Recombinant Human TDGF1, Fc-tagged | +Inquiry |
TDGF1-495H | Recombinant Human Teratocarcinoma-Derived Growth Factor 1 | +Inquiry |
TDGF1-572H | Active Recombinant Human TDGF1 protein, His-tagged | +Inquiry |
TDGF1-3556H | Recombinant Human TDGF1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TDGF1-832RCL | Recombinant Rat TDGF1 cell lysate | +Inquiry |
TDGF1-2432HCL | Recombinant Human TDGF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TDGF1 Products
Required fields are marked with *
My Review for All TDGF1 Products
Required fields are marked with *
0
Inquiry Basket