Active Recombinant Human TGFB2, Animal Free

Cat.No. : TGFB2-127H
Product Overview : Recombinant human TGF-beta2 is a 27.08 kDa protein composed of two identical 118 amino acid polypeptide chains linked by a single disulphide bond. Human recombinant protein expressed in Nicotiana benthamiana. Recombinant human TGF-beta-2 contains a 6-His-tag at the N-terminal end, is produced by transient expression in non-transgenic plants and is purified by sequential chromatography (FPLC). This product contains no animal–derived components or impurities. Animal free product.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Nicotiana Benthamiana
Tag : Non
Description : Recombinant human TGF-beta2 is a 27.08 kDa protein composed of two identical 118 amino acid peptide chains linked by a single disulphide bond. Transforming growth factor–beta is a family of five related cytokines that have been shown on a wide variety of normal and neoplastic cells, indicating the importance of these homo-dimmer proteins as multi-functional regulators of cellular activity. The three mammalian isoforms of TGF-beta (TGF-beta1, TGF-beta2 and TGF-beta3) signal through the same receptor and elicit similar biological responses. They are involved in physiological processes as embryogenesis, tissue remodelling and wound healing.
Form : Lyophilized from a Tris HCl 0.05M buffer at pH 7.4.
Bio-activity : The biological activity of TGF-beta2 is measured in culture by its ability to inhibit the mink lung epithelial (Mv1Lu) cells proliferation. ED50 ≤ 50ng/ml
Molecular Mass : Recombinant human TGF-beta2 is a 27.08 kDa protein composed of two identical 118 amino acid polypeptide chains linked by a single disulphide bond.
AA Sequence : HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTIN PEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
Endotoxin : < 0.04="" eu="" ug="" protein="" (lal="">
Purity : >97% by SDS-PAGE gel
Applications : Cell culture, Western blot
Storage : This lyophilized preparation is stable at 2-8o C for short term, long storage it should be kept at -20oC. Reconstituted protein should be stored in working aliquots at –20°C. It is recommended to add a carrier protein (0.1% HSA or BSA). Repeated freezing and thawing is not recommended.
Reconstitution : Lyophilized protein should be reconstituted in water to a concentration of 25-50 ng / ul. Due to the protein nature, dimmers and multimers may be observed. Upon reconstitution, It can be stored in working aliquots at –20°C for future use. Optimal reconstitution please follow batch Quality Control sheet instructions.
Gene Name TGFB2 transforming growth factor, beta 2 [ Homo sapiens ]
Official Symbol TGFB2
Synonyms TGFB2; transforming growth factor, beta 2; transforming growth factor beta-2; G-TSF; cetermin; polyergin; BSC-1 cell growth inhibitor; glioblastoma-derived T-cell suppressor factor; TGF-beta2; MGC116892;
Gene ID 7042
mRNA Refseq NM_001135599
Protein Refseq NP_001129071
MIM 190220
UniProt ID P61812
Chromosome Location 1q41
Pathway ATF-2 transcription factor network, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem;
Function beta-amyloid binding; cytokine activity; growth factor activity; protein binding; contributes_to protein binding; protein heterodimerization activity; protein homodimerization activity; receptor binding; receptor signaling protein serine/threonine kinase activity; transforming growth factor beta receptor binding; type II transforming growth factor beta receptor binding; type II transforming growth factor beta receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TGFB2 Products

Required fields are marked with *

My Review for All TGFB2 Products

Required fields are marked with *

0
cart-icon
0
compare icon