Active Recombinant Human TGFB2 Protein
Cat.No. : | TGFB2-016H |
Product Overview : | Purified recombinant protein of Human transforming growth factor, beta 2 (TGFB2), transcript variant 2, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Non |
Description : | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGF-beta family members. Disruption of the TGF-beta/SMAD pathway has been implicated in a variety of human cancers. A chromosomal translocation that includes this gene is associated with Peters' anomaly, a congenital defect of the anterior chamber of the eye. Mutations in this gene may be associated with Loeys-Dietz syndrome. This gene encodes multiple isoforms that may undergo similar proteolytic processing. [provided by RefSeq, Aug 2016]. |
Bio-activity : | Determined by its ability to inhibit the mouse IL-4-dependent proliferation of mouse HT-2 cells. ED50 was found to be < 0.2 ng/ml, corresponding to a specific activity of > 5 x 10^6 units/mg. |
Molecular Mass : | 25 kDa |
AA Sequence : | ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | > 95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Resuspend the protein in the desired concentration in proper buffer |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2 |
Gene Name | TGFB2 transforming growth factor, beta 2 [ Homo sapiens ] |
Official Symbol | TGFB2 |
Synonyms | TGFB2; transforming growth factor, beta 2; transforming growth factor beta-2; G-TSF; cetermin; polyergin; BSC-1 cell growth inhibitor; glioblastoma-derived T-cell suppressor factor; TGF-beta2; MGC116892; |
Gene ID | 7042 |
mRNA Refseq | NM_001135599 |
Protein Refseq | NP_001129071 |
MIM | 190220 |
UniProt ID | P61812 |
◆ Recombinant Proteins | ||
TGFB2-1502HFL | Recombinant Full Length Human TGFB2 Protein, C-Flag-tagged | +Inquiry |
TGFB2-4687R | Recombinant Rhesus monkey TGFB2 Protein, His-tagged | +Inquiry |
TGFB2-1566H | Recombinant human TGFB2, Active | +Inquiry |
TGFB2-47H | Active Recombinant Human TGFB2 Protein, Animal Free | +Inquiry |
TGFB2-6037R | Recombinant Rat TGFB2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFB2-1119HCL | Recombinant Human TGFB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TGFB2 Products
Required fields are marked with *
My Review for All TGFB2 Products
Required fields are marked with *
0
Inquiry Basket