Active Recombinant Human TGFBR1, Fc-tagged, Biotinylated
Cat.No. : | TGFBR1-695H |
Product Overview : | The recombinant human TGFBR1-Fc fusion protein is expressed as a 320 amino acid protein consisting of Leu34 - Glu125 region of TGFBR1 (UniProt accession #P36897) and a C-terminal Fc fusion from human IgG1, which exists as a dimer/tetramer/octamer under non-reducing condition. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 34-125 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Immobilized TGFBR1 protein binds human TGFβ1 in a functional ELISA. Blocks TGFβ1-mediated signaling activity. |
Molecular Mass : | Calculated molecular mass (kDa): 35.6; Estimated by SDS-PAGE under reducing condition (kDa): ~45 |
AA Sequence : | LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCN KIELPTTVKSSPGLGPVESTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY TLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Conjugation : | Biotin |
Gene Name | TGFBR1 transforming growth factor, beta receptor 1 [ Homo sapiens ] |
Official Symbol | TGFBR1 |
Synonyms | TGFBR1; transforming growth factor, beta receptor 1; transforming growth factor, beta receptor I (activin A receptor type II like kinase, 53kD); TGF-beta receptor type-1; activin A receptor type II like kinase; 53kDa; ACVRLK4; ALK 5; tbetaR-I; TGF-beta receptor type I; TGF-beta type I receptor; activin receptor-like kinase 5; transforming growth factor beta receptor I; serine/threonine-protein kinase receptor R4; activin A receptor type II-like kinase, 53kD; activin A receptor type II-like kinase, 53kDa; transforming growth factor-beta receptor type I; activin A receptor type II-like protein kinase of 53kD; transforming growth factor, beta receptor I (activin A receptor type II-like kinase, 53kD); AAT5; ALK5; MSSE; SKR4; ALK-5; LDS1A; LDS2A; TGFR-1; |
Gene ID | 7046 |
mRNA Refseq | NM_001130916 |
Protein Refseq | NP_001124388 |
MIM | 190181 |
UniProt ID | P36897 |
Chromosome Location | 9q22 |
Pathway | ALK1 signaling events, organism-specific biosystem; Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Chronic myeloid leukemia, organism-specific biosystem; Chronic myeloid leukemia, conserved biosystem; |
Function | ATP binding; I-SMAD binding; SMAD binding; SMAD binding; contributes_to growth factor binding; metal ion binding; nucleotide binding; protein binding; protein heterodimerization activity; protein serine/threonine kinase activity; receptor activity; transforming growth factor beta binding; contributes_to transforming growth factor beta binding; transforming growth factor beta binding; transforming growth factor beta receptor activity, type I; transforming growth factor beta-activated receptor activity; transforming growth factor beta-activated receptor activity; transforming growth factor beta-activated receptor activity; contributes_to transforming growth factor beta-activated receptor activity; transmembrane receptor protein serine/threonine kinase activity; type II transforming growth factor beta receptor binding; type II transforming growth factor beta receptor binding; ubiquitin protein ligase binding; |
◆ Recombinant Proteins | ||
TGFBR1-1292H | Recombinant Human TGFBR1 Protein (T200-M503), His tagged | +Inquiry |
TGFBR1-701H | Recombinant Human TGFBR1 Protein, MYC/DDK-tagged | +Inquiry |
TGFBR1-1293H | Recombinant Human TGFBR1 Protein (T200-M503), Tag Free | +Inquiry |
TGFBR1-716H | Recombinant Human TGFBR1, GST-His | +Inquiry |
TGFBR1-143H | Active Recombinant Human TGFBR1 protein(Thr200-Met503), His&GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFBR1-001HCL | Recombinant Human TGFBR1 cell lysate | +Inquiry |
TGFBR1-2482HCL | Recombinant Human TGFBR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TGFBR1 Products
Required fields are marked with *
My Review for All TGFBR1 Products
Required fields are marked with *