Species : |
Human |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
166 |
Description : |
4-1BB receptor, also named TNFRSF9 is a member of the TNF superfamily of receptors. It is mainly expressed on the surface of a variety of T cells, but also found in B cells, monocytes, and various transformed cell lines. 4-1BB receptor binds to 4-1BBL, and they co-stimulate activity for activated T cells. Signaling by 4-1BB Receptor has been implicated in the antigen-presentation process and generation of cytotoxic T cells. Crosslinking of 4-1BB Receptor enhances T cell proliferation, IL-2 secretion survival and cytolytic activity. Further, it can enhance immune activity to eliminate tumors in mice. |
Form : |
Lyophilized from a 0.2μm filtered concentrated solution in 10 mM PB, pH 8.0, 150 mM NaCl. |
Bio-activity : |
Fully biologically active when compared to standard. The biological activity is determined by its inhibitory effect of IL-8 production using human peripheral blood mononuclear cells. About 90 % of inibition was seen using a concentration of 1 µg for both 4-1BB Ligand and 4-1BB Receptor. |
Molecular Mass : |
Approximately 17.7 kDa, a single non-glycosylated polypeptide chain containing 166 amino acids. |
AA Sequence : |
ERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHS |
Endotoxin : |
Less than 1 EU/μg of rHu4-1BB Receptor as determined by LAL method. |
Purity : |
>97% by SDS-PAGE and HPLC analysis. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |