Active Recombinant Human TNFSF12 Protein
| Cat.No. : | TNFSF12-200T |
| Product Overview : | Recombinant Human TNFSF12 Protein without tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | CHO |
| Description : | TWEAK, short for TNF-related weak inducer of apoptosis, is also known as TNFSF12 and DR3LG. It is a type II transmembrane protein belonging to the TNF superfamily. It is expressed widely in many tissues, such as the heart, skeletal muscle, spleen and peripheral blood. Binding of TWEAK to its receptor TWEAKR induces NF-κB activation, chemokine secretion and apoptosis in certain cell types. TWEAK has also been reported to promote endothelial cell proliferation and migration, thus serving as a regulator of angiogenesis. |
| Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : | ED50 < 1 ng/mL, measured in a cell cytotoxicity assay using HTB-38 (HT-29) cells. |
| Molecular Mass : | 20-22 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : | RKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH |
| Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
| Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
| Storage : | Lyophilized recombinant Human TWEAK remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human TWEAK should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
| Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
| Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
| Gene Name | TNFSF12 tumor necrosis factor (ligand) superfamily, member 12 [ Homo sapiens ] |
| Official Symbol | TNFSF12 |
| Synonyms | TNFSF12; tumor necrosis factor (ligand) superfamily, member 12; tumor necrosis factor ligand superfamily member 12; APO3L; DR3LG; TWEAK; APO3 ligand; APO3/DR3 ligand; TNF-related WEAK inducer of apoptosis; MGC20669; MGC129581; |
| Gene ID | 8742 |
| mRNA Refseq | NM_003809 |
| Protein Refseq | NP_003800 |
| MIM | 602695 |
| UniProt ID | O43508 |
| ◆ Recombinant Proteins | ||
| TNFSF12-3605H | Recombinant Human TNFSF12 protein, His-SUMO-tagged | +Inquiry |
| TNFSF12-1068H | Recombinant Human TNFSF12 protein, His-tagged | +Inquiry |
| TNFSF12-4686R | Recombinant Rhesus Macaque TNFSF12 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TNFSF12-305H | Active Recombinant Human TNFSF12 Protein (Lys56-His249), C-His tagged, Animal-free, Carrier-free | +Inquiry |
| TNFSF12-4501Z | Recombinant Zebrafish TNFSF12 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFSF12-1204RCL | Recombinant Rat TNFSF12 cell lysate | +Inquiry |
| TNFSF12-1155CCL | Recombinant Cynomolgus TNFSF12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFSF12 Products
Required fields are marked with *
My Review for All TNFSF12 Products
Required fields are marked with *
