Active Recombinant Human TNFSF13 Protein, C-His-tagged

Cat.No. : TNFSF13-318H
Product Overview : Recombinant Active Human TNFSF13 Protein with His tag (C-ter) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 105-250 a.a.
Description : The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF17/BCMA, a member of the TNF receptor family. This protein and its receptor are both found to be important for B cell development. In vitro experiments suggested that this protein may be able to induce apoptosis through its interaction with other TNF receptor family proteins such as TNFRSF6/FAS and TNFRSF14/HVEM. Alternative splicing results in multiple transcript variants. Some transcripts that skip the last exon of the upstream gene (TNFSF12) and continue into the second exon of this gene have been identified; such read-through transcripts are contained in GeneID 407977, TNFSF12-TNFSF13. [provided by RefSeq, Oct 2010]
Form : Powder
Bio-activity : Measured by its ability to induce cell death in Jurkat cells. The ED50 for this effect is 2.6-4.0 μg/mL.
AA Sequence : MAVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL
Endotoxin : Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
Purity : > 98% (by SDS-PAGE)
Applications : SDS-PAGE
Notes : For laboratory research only, not for drug, diagnostic or other use.
Storage : Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer : PBS (pH 8.0) and 0.1% Sarkosyl.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.
Gene Name TNFSF13 tumor necrosis factor (ligand) superfamily, member 13 [ Homo sapiens ]
Official Symbol TNFSF13
Synonyms TNFSF13; tumor necrosis factor (ligand) superfamily, member 13; tumor necrosis factor ligand superfamily member 13; APRIL; CD256; a proliferation-inducing ligand; tumor necrosis factor-like protein ZTNF2; tumor necrosis factor-related death ligand-1; TNF- and APOL-related leukocyte expressed ligand 2; TALL2; ZTNF2; TALL-2; TRDL-1; FLJ57090; UNQ383/PRO715;
Gene ID 8741
mRNA Refseq NM_001198622
Protein Refseq NP_001185551
MIM 604472
UniProt ID O75888

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFSF13 Products

Required fields are marked with *

My Review for All TNFSF13 Products

Required fields are marked with *

0
cart-icon
0
compare icon