Active Recombinant Human VEGFA, Isoform 165, His-tagged, Biotinylated

• Cat.No.: VEGFA-711H
• Product Overview: Human VEGF165, also known as VEGF, is expressed as a 176-amino acid protein consisting of the region Ala27- Arg191 of VEGF (UniProt Accession #P15692-4, isoform VEGF165) and a C-terminal His-tag. It contains 1 potential sites for N-linked glycosylation and exists as a dimer under non-reducing condition.

Specification

• Species: Human
• Source: Human Cells
• Tag: His
• Protein Length: 176-o a.a.
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
• Bio-activity: Binds its receptors (FLT1, KDR) and anti-VEGF monoclonal antobodies with high affinity (KD< 10 nM as measured by ELISA). Stimulates HUVEC (human umbilical vein endothelial cells) proliferation and certain tumor cell growth.
• Molecular Mass: Calculated molecular mass (kDa): 20.5; Estimated by SDS-PAGE under reducing condition (kDa): ~30 (probably due to glycosylation)
• AA Sequence: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEES NITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKA RQLELNERTCRCDKPRRSTGHHHHHHHH
• Endotoxin: <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
• Purity: >95% judged by SDS-PAGE under reducing condition.
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
• Conjugation: Biotin

Gene Information

• Gene Name: VEGFA vascular endothelial growth factor A [ Homo sapiens ]
• Official Symbol: VEGFA
• Synonyms: VEGFA; vascular endothelial growth factor A; vascular endothelial growth factor , VEGF; VEGF A; VPF; vascular permeability factor; VEGF; MVCD1; MGC70609
• Gene ID: 7422
• mRNA Refseq: NM_001025366
• Protein Refseq: NP_001020537
• UniProt ID: P15692
• Chromosome Location: 6p12
• Pathway: Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endochondral Ossification, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem
• Function: cell surface binding; chemoattractant activity; cytokine activity; cytokine activity; extracellular matrix binding; fibronectin binding; growth factor activity; growth factor activity; heparin binding; heparin binding; platelet-derived growth factor receptor binding; protein binding; protein heterodimerization activity; protein homodimerization activity; receptor agonist activity; vascular endothelial growth factor receptor 1 binding; vascular endothelial growth factor receptor 2 binding; vascular endothelial growth factor receptor binding