Active Recombinant Human XCL1 Protein (92 aa)
Cat.No. : | XCL1-084X |
Product Overview : | Recombinant Human XCL1 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 92 |
Description : | Lymphotactin is the only known member of the C-chemokine family and signals through the receptor XCR1, formally known as GPR5. The spleen shows the highest level of lymphotactin compared to peripheral leukocytes, lung, colon and small intestine. Lymphotactin is chemotactic towards lymphocytes but not towards monocytes or neutrophils. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. Determined by its ability to chemoattract human T cells using a concentration range of 10.0-100.0 ng/mL, corresponding to a Specific Activity of >1 × 10^4 IU/mg. |
Molecular Mass : | 10.0 kDa, a single non-glycosylated polypeptide chain containing 92 amino acids. |
AA Sequence : | GSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG |
Endotoxin : | Less than 1 EU/mg of rHuCXCL13 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH7.4, 150mM NaCl. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | XCL1 chemokine (C motif) ligand 1 [ Homo sapiens ] |
Official Symbol | XCL1 |
Synonyms | XCL1; chemokine (C motif) ligand 1; LTN, SCYC1, small inducible cytokine subfamily C, member 1 (lymphotactin); lymphotactin; ATAC; LPTN; SCM 1; SCM 1a; SCM-1-alpha; lymphotaxin; cytokine SCM-1; c motif chemokine 1; XC chemokine ligand 1; single cysteine motif 1a; small-inducible cytokine C1; small inducible cytokine subfamily C, member 1 (lymphotactin); LTN; SCM1; SCM-1; SCM1A; SCYC1; SCM-1a; |
Gene ID | 6375 |
mRNA Refseq | NM_002995 |
Protein Refseq | NP_002986 |
MIM | 600250 |
UniProt ID | P47992 |
◆ Recombinant Proteins | ||
XCL1-5228R | Recombinant Rhesus monkey XCL1 Protein, His-tagged | +Inquiry |
XCL1-06H | Recombinant Human XCL1 protein, His/Fc-tagged | +Inquiry |
XCL1-159H | Active Recombinant Human XCL1, HIgG1 Fc-tagged, mutant | +Inquiry |
XCL1-1187C | Recombinant Cynomolgus XCL1 Protein, His-tagged | +Inquiry |
XCL1-28843TH | Recombinant Human XCL1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
XCL1-466HCL | Recombinant Human XCL1 cell lysate | +Inquiry |
XCL1-480MCL | Recombinant Mouse XCL1 cell lysate | +Inquiry |
XCL1-452CCL | Recombinant Cynomolgus XCL1 cell lysate | +Inquiry |
XCL1-001CCL | Recombinant Canine XCL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All XCL1 Products
Required fields are marked with *
My Review for All XCL1 Products
Required fields are marked with *
0
Inquiry Basket