Active Recombinant Mouse Adipoq Protein

• Cat.No.: Adipoq-17M
• Product Overview: Recombinant mouse gAcrp30 (rmgAcrp30) produced in E. coli is a single non-glycosylated polypeptide chain containing of 144 amino acids. A fully biologically active molecule, rmgAcrp30 has a molecular mass of 16.5 kDa analyzed by non-reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Mouse
• Source: E.coli
• Description: Enables hormone activity and identical protein binding activity. Involved in several processes, including detection of oxidative stress; negative regulation of cold-induced thermogenesis; and regulation of protein serine/threonine kinase activity. Acts upstream of or within with a positive effect on gene expression. Acts upstream of or within several processes, including brown fat cell differentiation; negative regulation of gluconeogenesis; and positive regulation of glucose import. Located in endoplasmic reticulum and extracellular space. Is expressed in several structures, including adipose tissue; axial musculature; gut; male reproductive gland or organ; and serum. Human ortholog(s) of this gene implicated in several diseases, including carcinoma (multiple); cardiovascular system disease (multiple); non-alcoholic fatty liver disease; primary open angle glaucoma; and type 2 diabetes mellitus. Orthologous to human ADIPOQ (adiponectin, C1Q and collagen domain containing).
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 2 μg/mL, measured by a cell proliferation assay using M1 cells, corresponding to a specific activity of > 500 units/mg.
• Molecular Mass: 16.5 kDa, observed by non-reducing SDS-PAGE.
• AA Sequence: KGEPGEAAYMYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE and HPLC analyses.
• Storage: Lyophilized recombinant mouse gAcrp30 (rmgAcrp30) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmgAcrp30 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: Adipoq adiponectin, C1Q and collagen domain containing [ Mus musculus (house mouse) ]
• Official Symbol: Adipoq
• Synonyms: Adipoq; adiponectin, C1Q and collagen domain containing; Ad; APN; Acdc; Adid; apM1; 30kDa; GBP28; adipo; Acrp30; adiponectin; 30 kDa adipocyte complement-related protein; adipocyte complement related protein; adipocyte complement-related 30 kDa protein; adipocyte, C1Q and collagen domain containing; adipocyte, C1q and collagen domain-containing protein; adipocyte-specific protein AdipoQ; adiponectin d
• Gene ID: 11450
• mRNA Refseq: NM_009605
• Protein Refseq: NP_033735
• UniProt ID: Q60994