Active Recombinant Mouse Bmp4 Protein
Cat.No. : | Bmp4-036M |
Product Overview : | Purified recombinant protein of Mouse bone morphogenetic protein 4 (Bmp4) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates heart development and adipogenesis. Homozygous knockout mice die in utero, while a conditional knockout mouse exhibits defects in heart development. Transgenic mice overexpressing this gene in a neuron-specific manner exhibit a phenotype resembling the rare hereditary connective tissue disease, fibrodysplasia ossificans progressiva. |
Bio-activity : | Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED50 for this effect is 5-15 ng/ml. |
Molecular Mass : | 24 kDa |
AA Sequence : | KKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCRKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Bmp4 bone morphogenetic protein 4 [ Mus musculus (house mouse) ] |
Official Symbol | Bmp4 |
Synonyms | Bmp4; bone morphogenetic protein 4; Bmp-4; Bmp2b; Bmp2b1; Bmp2b-1; bone morphogenetic protein 4; bone morphogenetic protein 2B |
Gene ID | 12159 |
mRNA Refseq | NM_007554 |
Protein Refseq | NP_031580 |
UniProt ID | P21275 |
◆ Recombinant Proteins | ||
BMP4-0772H | Recombinant Human BMP4 Protein (Ala24-Arg408), N-His tagged | +Inquiry |
BMP4-02P | Recombinant Pig BMP4 Protein (Arg227-Cys408), C-His tagged, Animal-free, Carrier-free | +Inquiry |
BMP4-4364H | Recombinant Human BMP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
BMP4-402H | Recombinant Human BMP4 Protein | +Inquiry |
Bmp4-583M | Active Recombinant Mouse BMP-4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP4-8432HCL | Recombinant Human BMP4 293 Cell Lysate | +Inquiry |
BMP4-8431HCL | Recombinant Human BMP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Bmp4 Products
Required fields are marked with *
My Review for All Bmp4 Products
Required fields are marked with *
0
Inquiry Basket