Active Recombinant Mouse Ccl21a Protein (110 aa)
Cat.No. : | Ccl21a-045C |
Product Overview : | Recombinant Mouse Ccl21a Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | 110 |
Description : | Exodus-2/CCL21 is a novel CC chemokine discovered independently by three groups from the EST database, and shows 21-33% identity to other CC chemokines. Exodus-2 contains the four conserved cysteines characteristic of β chemokines plus two additional cysteines in its unusually long carboxylterminal domain. It is expressed in lymph nodes of certain endothelial cells, and in the spleen and appendix. Exodus-2 chemoattracts T and B lymphocytes and inhibits hematopoiesis. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. Determined by its ability to chemoattract total murine T cell population using a concentration range of 10.0 -100.0 ng/mL, corresponding to a Specific Activity of >1 × 10^4 IU/mg. |
Molecular Mass : | 12.0 kDa, a single, non-glycosylated polypeptide chain containing 110 amino acids. |
AA Sequence : | SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG |
Endotoxin : | Less than 1 EU/μg of rMuExodus-2/CCL21 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2 μm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Ccl21a chemokine (C-C motif) ligand 21A (serine) [ Mus musculus (house mouse) ] |
Official Symbol | Ccl21a |
Synonyms | Ccl21a; chemokine (C-C motif) ligand 21A (serine); ALP; SLC; plt; CKb9; Tca4; 6Ckine; Gm1987; Scya21; 6CKBAC2; SCYA21a; Scya21b; C-C motif chemokine 21a; CC chemokine 6Ckine-ser; CCL21-Ser; beta-chemokine exodus-2; exodus-2; small inducible cytokine A21a; thymus-derived chemotactic agent 4 |
Gene ID | 18829 |
mRNA Refseq | NM_011124 |
Protein Refseq | NP_035254 |
UniProt ID | P84444 |
◆ Recombinant Proteins | ||
CCL21A-897M | Recombinant Mouse CCL21A protein (Met1-Gly133), His-tagged | +Inquiry |
Ccl21a-3409M | Recombinant Mouse Ccl21a protein(Met1-Gly133) | +Inquiry |
CCL21A-2965M | Recombinant Mouse CCL21A Protein | +Inquiry |
CCL21A-896M | Recombinant Mouse CCL21A Protein (Met1-Gly133) | +Inquiry |
Ccl21a-5428M | Recombinant Mouse Ccl21a Protein (Ser24-Gly133) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ccl21a Products
Required fields are marked with *
My Review for All Ccl21a Products
Required fields are marked with *
0
Inquiry Basket