| Species : |
Mouse |
| Source : |
E.coli |
| Protein Length : |
110 |
| Description : |
Exodus-2/CCL21 is a novel CC chemokine discovered independently by three groups from the EST database, and shows 21-33% identity to other CC chemokines. Exodus-2 contains the four conserved cysteines characteristic of β chemokines plus two additional cysteines in its unusually long carboxylterminal domain. It is expressed in lymph nodes of certain endothelial cells, and in the spleen and appendix. Exodus-2 chemoattracts T and B lymphocytes and inhibits hematopoiesis. |
| Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : |
Fully biologically active when compared to standard. Determined by its ability to chemoattract total murine T cell population using a concentration range of 10.0 -100.0 ng/mL, corresponding to a Specific Activity of >1 × 10^4 IU/mg. |
| Molecular Mass : |
12.0 kDa, a single, non-glycosylated polypeptide chain containing 110 amino acids. |
| AA Sequence : |
SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG |
| Endotoxin : |
Less than 1 EU/μg of rMuExodus-2/CCL21 as determined by LAL method. |
| Purity : |
>97% by SDS-PAGE and HPLC analyses. |
| Storage : |
This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
| Storage Buffer : |
Lyophilized from a 0.2 μm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions. |