Active Recombinant Mouse Ccl28 Protein

Cat.No. : Ccl28-152M
Product Overview : Purified recombinant protein of Mouse chemokine (C-C motif) ligand 28 (Ccl28) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Chemotactic for resting CD4, CD8 T-cells and eosinophils. Binds to CCR10 and induces calcium mobilization in a dose-dependent manner.
Bio-activity : Determined by its ability to chemoattract murine lymphocytes using a concentration range of 1.0-10.0 ng/ml.
Molecular Mass : 12.6 kDa
AA Sequence : SEAILPMASSCCTEVSHHVSGRLLERVSSCSIQRADGDCDLAAVILHVKRRRICISPHNRTLKQWMRASEVKKNGRENVCSGKKQPSRKDRKGHTTRKHRTRGTHRHEASR
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Ccl28 chemokine (C-C motif) ligand 28 [ Mus musculus (house mouse) ]
Official Symbol Ccl28
Synonyms Ccl28; chemokine (C-C motif) ligand 28; MEC; CCK1; Scya28; C-C motif chemokine 28; small-inducible cytokine A28
Gene ID 56838
mRNA Refseq NM_020279
Protein Refseq NP_064675
UniProt ID Q9JIL2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ccl28 Products

Required fields are marked with *

My Review for All Ccl28 Products

Required fields are marked with *

0
cart-icon
0
compare icon