Active Recombinant Mouse Ccl28 Protein
Cat.No. : | Ccl28-152M |
Product Overview : | Purified recombinant protein of Mouse chemokine (C-C motif) ligand 28 (Ccl28) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Chemotactic for resting CD4, CD8 T-cells and eosinophils. Binds to CCR10 and induces calcium mobilization in a dose-dependent manner. |
Bio-activity : | Determined by its ability to chemoattract murine lymphocytes using a concentration range of 1.0-10.0 ng/ml. |
Molecular Mass : | 12.6 kDa |
AA Sequence : | SEAILPMASSCCTEVSHHVSGRLLERVSSCSIQRADGDCDLAAVILHVKRRRICISPHNRTLKQWMRASEVKKNGRENVCSGKKQPSRKDRKGHTTRKHRTRGTHRHEASR |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Ccl28 chemokine (C-C motif) ligand 28 [ Mus musculus (house mouse) ] |
Official Symbol | Ccl28 |
Synonyms | Ccl28; chemokine (C-C motif) ligand 28; MEC; CCK1; Scya28; C-C motif chemokine 28; small-inducible cytokine A28 |
Gene ID | 56838 |
mRNA Refseq | NM_020279 |
Protein Refseq | NP_064675 |
UniProt ID | Q9JIL2 |
◆ Recombinant Proteins | ||
CCL28-1407H | Recombinant Human CCL28 Protein (Ile20-Tyr127) | +Inquiry |
CCL28-113H | Recombinant Human Chemokine (C-C Motif) Ligand 28, His-tagged | +Inquiry |
CCL28-68H | Recombinant Human CCL28 Protein, Biotin-tagged | +Inquiry |
CCL28-179H | Recombinant Human CCL28 Protein, Mature chain, Tag Free, Biotinylated | +Inquiry |
CCL28-019H | Recombinant Human CCL28 Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL28-7724HCL | Recombinant Human CCL28 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ccl28 Products
Required fields are marked with *
My Review for All Ccl28 Products
Required fields are marked with *