Active Recombinant Mouse Ccl28 Protein (111 aa)

Cat.No. : Ccl28-041C
Product Overview : Recombinant Mouse Ccl28 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Protein Length : 111
Description : Mouse CCL28 (CC chemokine ligand 28) is a novel CC chemokine cloned from a Rag1 mouse kidney cDNA library. Human and mouse CCL28 are highly conserved, sharing 83% aa identity in their mature regions. Among CC chemokines, CCL28 shares the most homology with CCL27/CTACK. The mouse CCL28 gene has been mapped to the distal region of chromosome 13. Mouse CCL28 is produced by epithelial cells. Based on Northern blot analysis, it is mainly expressed in testes, kidney and brain. The receptor for CCL28 has been identified as the CCR10 (GPR2 orphan receptor) which is also the receptor for CCL27/CTACK.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Fully biologically active when compared to standard. Determined by its ability to chemoattract murine lymphocytes using a concentration range of 1.0-10.0 ng/mL, corresponding to a Specific Activity of >1 × 10^5 IU/mg.
Molecular Mass : 12.6 kDa, a single, non-glycosylated polypeptide chain containing 111 amino acids.
AA Sequence : SEAILPMASSCCTEVSHHVSGRLLERVSSCSIQRADGDCDLAAVILHVKRRRICISPHNRTLKQWMRASEVKKNGRENVCSGKKQPSRKDRKGHTTRKHRTRGTHRHEASR
Endotoxin : Less than 1 EU/μg of rMuMEC/CCL28 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2 μm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions.
Gene Name Ccl28 chemokine (C-C motif) ligand 28 [ Mus musculus ]
Official Symbol Ccl28
Synonyms CCL28; chemokine (C-C motif) ligand 28; C-C motif chemokine 28; small inducible cytokine A28; small-inducible cytokine A28; MEC; CCK1; Scya28;
Gene ID 56838
mRNA Refseq NM_020279
Protein Refseq NP_064675
UniProt ID Q9JIL2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ccl28 Products

Required fields are marked with *

My Review for All Ccl28 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon