Active Recombinant Mouse Cd200 Protein, His-tagged

• Cat.No.: Cd200-027M
• Product Overview: Recombinant mouse CD200, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: Insect cells
• Tag: His
• Description: Costimulates T-cell proliferation. May regulate myeloid cell activity in a variety of tissues.
• Form: Liquid
• Bio-activity: Measured by its binding ability in a functional ELISA with Mouse CD200 R1.
• Molecular Mass: 23.5 kDa
• AA Sequence: QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKG
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -106 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.25 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: Cd200 CD200 antigen [ Mus musculus (house mouse) ]
• Official Symbol: Cd200
• Synonyms: Cd200; CD200 antigen; OX; Mox; OX2; Mox2; OX-2 membrane glycoprotein; MRC OX-2 antigen; antigen identified by monoclonal antibody MRC OX-2
• Gene ID: 17470
• mRNA Refseq: NM_010818
• Protein Refseq: NP_034948
• UniProt ID: O54901