Active Recombinant Mouse Cd200 Protein, His-tagged
Cat.No. : | Cd200-027M |
Product Overview : | Recombinant mouse CD200, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect cells |
Tag : | His |
Description : | Costimulates T-cell proliferation. May regulate myeloid cell activity in a variety of tissues. |
Form : | Liquid |
Bio-activity : | Measured by its binding ability in a functional ELISA with Mouse CD200 R1. |
Molecular Mass : | 23.5 kDa |
AA Sequence : | QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKG |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE, Bioactivity |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -106 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.25 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | Cd200 CD200 antigen [ Mus musculus (house mouse) ] |
Official Symbol | Cd200 |
Synonyms | Cd200; CD200 antigen; OX; Mox; OX2; Mox2; OX-2 membrane glycoprotein; MRC OX-2 antigen; antigen identified by monoclonal antibody MRC OX-2 |
Gene ID | 17470 |
mRNA Refseq | NM_010818 |
Protein Refseq | NP_034948 |
UniProt ID | O54901 |
◆ Recombinant Proteins | ||
CD200-3071M | Active Recombinant Mouse CD200 protein, Fc-Avi-tagged, Biotinylated | +Inquiry |
CD200-164H | Active Recombinant Human CD200, Fc-tagged | +Inquiry |
CD200-305H | Recombinant Human CD200 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
CD200-002M | Active Recombinant Mouse CD200, MIgG2a Fc-tagged, mutant | +Inquiry |
CD200-0740H | Recombinant Human CD200 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD200-1041CCL | Recombinant Cynomolgus CD200 cell lysate | +Inquiry |
CD200-2707HCL | Recombinant Human CD200 cell lysate | +Inquiry |
CD200-2638MCL | Recombinant Mouse CD200 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cd200 Products
Required fields are marked with *
My Review for All Cd200 Products
Required fields are marked with *