Active Recombinant Mouse Cd200 Protein, His-tagged

Cat.No. : Cd200-027M
Product Overview : Recombinant mouse CD200, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Insect cells
Tag : His
Description : Costimulates T-cell proliferation. May regulate myeloid cell activity in a variety of tissues.
Form : Liquid
Bio-activity : Measured by its binding ability in a functional ELISA with Mouse CD200 R1.
Molecular Mass : 23.5 kDa
AA Sequence : QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKG
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -106 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name Cd200 CD200 antigen [ Mus musculus (house mouse) ]
Official Symbol Cd200
Synonyms Cd200; CD200 antigen; OX; Mox; OX2; Mox2; OX-2 membrane glycoprotein; MRC OX-2 antigen; antigen identified by monoclonal antibody MRC OX-2
Gene ID 17470
mRNA Refseq NM_010818
Protein Refseq NP_034948
UniProt ID O54901

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cd200 Products

Required fields are marked with *

My Review for All Cd200 Products

Required fields are marked with *

0
cart-icon
0
compare icon