Active Recombinant Rat Cxcl2 Protein (69 aa)

Cat.No. : Cxcl2-387C
Product Overview : Recombinant Rat GRO-β/CINC-3/CXCL2 produced in E. coli is a single non-glycosylated polypeptide chain containing 69 amino acids. A fully biologically active molecule, rrGRO-β has a molecular mass of 7.6kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Protein Length : 69
Description : Chemokine (C-X-C motif) ligand 2(CXCL2) is a small cytokine belonging to the CXC chemokine family that is also called macrophage inflammatory protein 2-alpha (MIP2-alpha), Growth-regulated protein beta (Gro-beta) and Gro oncogene-2 (Gro-2). CXCL2 shares 90% amino acid sequence with CXCL1/GROα. The GRO proteins are chemotactic for neutrophils and basophils and can activate them through their CXCR1 or CXCR2 receptors.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : The EC50 value of Rat GRO-β/CINC-3/CXCL2 on Ca^2+ mobilization assay in CHO-K1/Gα15/rCXCR2 cells (human Gα15 and rat CXCR2 stably expressed in CHO-K1 cells) is less than 10 ng/mL.
Molecular Mass : 7.6 kDa, observed by reducing SDS-PAGE.
AA Sequence : SELRCQCLTTLPRVDFKNIQSLTVTPPGPHCAQTEVIATLKDGHEVCLNPEAPLVQRIVQKILNKGKAN
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE.
Storage : Lyophilized recombinant Rat GRO-β/CINC-3/CXCL2 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Rat GRO-β/CINC-3/CXCL2 should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name Cxcl2 chemokine (C-X-C motif) ligand 2 [ Rattus norvegicus ]
Official Symbol Cxcl2
Synonyms CXCL2; chemokine (C-X-C motif) ligand 2; C-X-C motif chemokine 2; MIP2; CINC-3; macrophage inflammatory protein 2; small inducible cytokine subfamily, member 2; cytokine-induced neutrophil chemoattractant 3; Mip-2; Scyb2;
Gene ID 114105
mRNA Refseq NM_053647
Protein Refseq NP_446099
UniProt ID P30348

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cxcl2 Products

Required fields are marked with *

My Review for All Cxcl2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon