Active Recombinant Rat Cxcl2 Protein (69 aa)
| Cat.No. : | Cxcl2-387C |
| Product Overview : | Recombinant Rat GRO-β/CINC-3/CXCL2 produced in E. coli is a single non-glycosylated polypeptide chain containing 69 amino acids. A fully biologically active molecule, rrGRO-β has a molecular mass of 7.6kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Protein Length : | 69 |
| Description : | Chemokine (C-X-C motif) ligand 2(CXCL2) is a small cytokine belonging to the CXC chemokine family that is also called macrophage inflammatory protein 2-alpha (MIP2-alpha), Growth-regulated protein beta (Gro-beta) and Gro oncogene-2 (Gro-2). CXCL2 shares 90% amino acid sequence with CXCL1/GROα. The GRO proteins are chemotactic for neutrophils and basophils and can activate them through their CXCR1 or CXCR2 receptors. |
| Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : | The EC50 value of Rat GRO-β/CINC-3/CXCL2 on Ca^2+ mobilization assay in CHO-K1/Gα15/rCXCR2 cells (human Gα15 and rat CXCR2 stably expressed in CHO-K1 cells) is less than 10 ng/mL. |
| Molecular Mass : | 7.6 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : | SELRCQCLTTLPRVDFKNIQSLTVTPPGPHCAQTEVIATLKDGHEVCLNPEAPLVQRIVQKILNKGKAN |
| Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
| Purity : | > 95% as analyzed by SDS-PAGE. |
| Storage : | Lyophilized recombinant Rat GRO-β/CINC-3/CXCL2 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Rat GRO-β/CINC-3/CXCL2 should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade. |
| Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
| Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
| Gene Name | Cxcl2 chemokine (C-X-C motif) ligand 2 [ Rattus norvegicus ] |
| Official Symbol | Cxcl2 |
| Synonyms | CXCL2; chemokine (C-X-C motif) ligand 2; C-X-C motif chemokine 2; MIP2; CINC-3; macrophage inflammatory protein 2; small inducible cytokine subfamily, member 2; cytokine-induced neutrophil chemoattractant 3; Mip-2; Scyb2; |
| Gene ID | 114105 |
| mRNA Refseq | NM_053647 |
| Protein Refseq | NP_446099 |
| UniProt ID | P30348 |
| ◆ Recombinant Proteins | ||
| CXCL2-1689R | Recombinant Rat CXCL2 Protein | +Inquiry |
| Cxcl2-395C | Active Recombinant Cotton Rat Cxcl2 | +Inquiry |
| Cxcl2-2396M | Active Recombinant Mouse Cxcl2 Protein | +Inquiry |
| Cxcl2-386C | Active Recombinant Rat Cxcl2 Protein (73 aa) | +Inquiry |
| CXCL2-246H | Recombinant Human X-C motif chemokine ligand 2 Protein, Tag Free | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXCL2-7168HCL | Recombinant Human CXCL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cxcl2 Products
Required fields are marked with *
My Review for All Cxcl2 Products
Required fields are marked with *
