Active Recombinant Mouse Dkk1 Protein (243 aa)

Cat.No. : Dkk1-293D
Product Overview : Recombinant Mouse Dickkopf-related protein 1 produced in CHO cells is a polypeptide chain containing 243 amino acids. A fully biologically active molecule, rmDKK-1 has a molecular mass of 19~20 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : CHO
Protein Length : 243
Description : Dickkopf related protein 1 (DKK1) is a chemokine that belongs to the DKK protein family, which also includes DKK-2, DKK-3 and DKK-4. DKK-1 was originally identified as a Xenopus head forming molecule that behaves as an antagonist for Wnt signaling. It is one of the most up-regulated genes during androgen-potentiated balding, with DKK-1 messenger RNA up-regulated a few hours after DHT treatment of hair follicles at the dermal papilla in vitro. Neutralizing bodies against DKK-1 reverses DHT effects on outer root sheath keratinocytes. DKK-1 expression is attenuated by L-threonate, a metabolite of ascorbate in vitro. DKK-1 promotes LRP6 internalization and degradation as it forms a ternary complex with the cell surface receptor Kremen. DKK-1 not only functions in head formation during development, but also regulates joint remodeling and bone formation indicating its potential role in the pathogenesis of rheumatoid arthritis and multiple myeloma.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 6 μg/mL, measured in stimulation of alkaline phosphatase activity using CCl-226 cells.
Molecular Mass : 19-20 kDa, observed by reducing SDS-PAGE.
AA Sequence : SATLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQASNSSRLHTCQRH
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE.
Storage : Lyophilized recombinant Mouse Dickkopf-related protein 1 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Mouse Dickkopf-related protein 1 should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name Dkk1 dickkopf homolog 1 (Xenopus laevis) [ Mus musculus ]
Official Symbol Dkk1
Synonyms DKK1; dickkopf homolog 1 (Xenopus laevis); dickkopf-related protein 1; dkk-1; dickkopf-1; mdkk-1;
Gene ID 13380
mRNA Refseq NM_010051
Protein Refseq NP_034181
UniProt ID O54908

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Dkk1 Products

Required fields are marked with *

My Review for All Dkk1 Products

Required fields are marked with *

0
cart-icon
0
compare icon