Active Recombinant Mouse EGF Protein
| Cat.No. : | EGF-75M |
| Product Overview : | Recombinant Mouse EGF Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Description : | Epidermal growth factor (EGF) is a growth factor that stimulates the proliferation, differentiation, and survival of epithelial and epidermal cells. EGF contains three intramolecular disulfide bonds and binds in high affinity to the epidermal growth factor receptor (EGFR). |
| Bio-activity : | 3T3 cell proliferation, ≤250 pg/mL |
| Molecular Mass : | Monomer, 6.2 kDa (54 aa) |
| AA Sequence : | MNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR |
| Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
| Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
| Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
| Storage : | Storage Prior to Reconstitution: -20 centigrade |
| Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
| Reconstitution : | Sterile water at 0.1 mg/mL |
| Shipping : | Room temperature |
| Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
| Gene Name | Egf epidermal growth factor [ Mus musculus (house mouse) ] |
| Official Symbol | EGF |
| Synonyms | EGF; epidermal growth factor; pro-epidermal growth factor; Pro-epidermal growth factor precursor (EGF); AI790464; |
| Gene ID | 13645 |
| mRNA Refseq | NM_010113 |
| Protein Refseq | NP_034243 |
| UniProt ID | P01132 |
| ◆ Recombinant Proteins | ||
| EGF-5993H | Recombinant Human EGF Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Egf-1410R | Recombinant Rat Egf Protein, His-tagged | +Inquiry |
| EGF-2038H | Recombinant Human EGF Protein (Asn971-Arg1023), C-His tagged | +Inquiry |
| EGF-06H | Recombinant Human epidermal growth factor Protein, Tag Free, Animal Free | +Inquiry |
| EGF-037H | Recombinant Human EGF Protein | +Inquiry |
| ◆ Native Proteins | ||
| Egf -635R | Native Rat Egf protein | +Inquiry |
| Egf-634M | Active Native Mouse Egf | +Inquiry |
| Egf -634M | Active Native Mouse Egf protein | +Inquiry |
| Egf-635R | Native Rat Egf | +Inquiry |
| EGF-26462TH | Native Human EGF | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EGF-2716HCL | Recombinant Human EGF cell lysate | +Inquiry |
| EGF-973MCL | Recombinant Mouse EGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGF Products
Required fields are marked with *
My Review for All EGF Products
Required fields are marked with *



