| Species : |
Mouse |
| Source : |
E.coli |
| Protein Length : |
172 |
| Description : |
Fibroblast Growth Factor 18 (FGF-18) is a pleiotropic cytokine belonging to the heparin-binding FGF family, which has 23 different members. Structurally, FGF-18 is closely related to FGF-8 and FGF-17. Like other FGFs, FGF-18 can bind to different FGF receptors in vivo. FGF-18 is expressed in various tissues and has multiple functions: during long bone growth, FGF-18 is expressed in perichondrium and developing joints, and regulates bone formation by inhibiting chondrocyte proliferation and differentiation; FGF-18 knock-out mice survive embryonic development, but exhibit skeletal abnormalities and die in the early neonatal period. FGF-18 also induces ectopic cartilage formation in the lung, and alters the morphology of the pulmonary mesenchyma. |
| Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : |
ED50 < 0.5 μg/mL, measured by a cell proliferation assay using 3T3 cells, corresponding to a specific activity of > 2 × 10^3 units/mg. |
| Molecular Mass : |
20.1 kDa, observed by non-reducing SDS-PAGE. |
| AA Sequence : |
EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQAELQKPFKYTTVTKRSR |
| Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
| Purity : |
> 95% by SDS-PAGE and HPLC analyses. |
| Storage : |
Lyophilized recombinant mouse Fibroblast Growth Factor 18 (rmFGF-18) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmFGF-18 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
| Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
| Reconstitution : |
Reconstituted in ddH2O at 100 μg/mL. |
