Active Recombinant Mouse Il13 Protein, His-tagged

• Cat.No.: Il13-256I
• Product Overview: Recombinant Mouse Il13 Protein with a His tag was expressed in CHO.

Specification

• Species: Mouse
• Source: CHO
• Tag: His
• Description: Interleukin-13 (IL-13), also known as T-cell activation protein P600, is an immunoregulatory cytokine belonging to the IL-4/IL-13 family. It is produced by activated Th2 cells, mast cells and NK cells. IL-13 signals through a receptor complex composed of IL-4Rα and IL13Rα1 (or IL13Rα2). IL-13 inhibits the expression of inflammatory cytokines such as IL-1β, TNF-α and IL-6 by monocytes and macrophages. It also induces B cell activation and IgE secretion.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 20 ng/mL, measured in a cell proliferation assay using R&D TF-1 cells.
• Molecular Mass: 14-30 kDa, observed by reducing SDS-PAGE.
• AA Sequence: PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPFHHHHHH
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant murine Interleukin-13 (IL-13), His remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, murine Interleukin-13 (IL-13), His should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Il13 interleukin 13 [ Mus musculus ]
• Official Symbol: Il13
• Synonyms: IL13; interleukin 13; interleukin-13; T-cell activation protein P600; Il-13
• Gene ID: 16163
• mRNA Refseq: NM_008355
• Protein Refseq: NP_032381
• UniProt ID: P20109