Active Recombinant Mouse Il13 Protein, His-tagged

Cat.No. : Il13-256I
Product Overview : Recombinant Mouse Il13 Protein with a His tag was expressed in CHO.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : CHO
Tag : His
Description : Interleukin-13 (IL-13), also known as T-cell activation protein P600, is an immunoregulatory cytokine belonging to the IL-4/IL-13 family. It is produced by activated Th2 cells, mast cells and NK cells. IL-13 signals through a receptor complex composed of IL-4Rα and IL13Rα1 (or IL13Rα2). IL-13 inhibits the expression of inflammatory cytokines such as IL-1β, TNF-α and IL-6 by monocytes and macrophages. It also induces B cell activation and IgE secretion.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 20 ng/mL, measured in a cell proliferation assay using R&D TF-1 cells.
Molecular Mass : 14-30 kDa, observed by reducing SDS-PAGE.
AA Sequence : PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPFHHHHHH
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE.
Storage : Lyophilized recombinant murine Interleukin-13 (IL-13), His remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, murine Interleukin-13 (IL-13), His should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name Il13 interleukin 13 [ Mus musculus ]
Official Symbol Il13
Synonyms IL13; interleukin 13; interleukin-13; T-cell activation protein P600; Il-13;
Gene ID 16163
mRNA Refseq NM_008355
Protein Refseq NP_032381
UniProt ID P20109

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il13 Products

Required fields are marked with *

My Review for All Il13 Products

Required fields are marked with *

0
cart-icon