Active Recombinant Mouse Il13 Protein, His-tagged
Cat.No. : | Il13-256I |
Product Overview : | Recombinant Mouse Il13 Protein with a His tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | CHO |
Tag : | His |
Description : | Interleukin-13 (IL-13), also known as T-cell activation protein P600, is an immunoregulatory cytokine belonging to the IL-4/IL-13 family. It is produced by activated Th2 cells, mast cells and NK cells. IL-13 signals through a receptor complex composed of IL-4Rα and IL13Rα1 (or IL13Rα2). IL-13 inhibits the expression of inflammatory cytokines such as IL-1β, TNF-α and IL-6 by monocytes and macrophages. It also induces B cell activation and IgE secretion. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 20 ng/mL, measured in a cell proliferation assay using R&D TF-1 cells. |
Molecular Mass : | 14-30 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPFHHHHHH |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant murine Interleukin-13 (IL-13), His remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, murine Interleukin-13 (IL-13), His should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Il13 interleukin 13 [ Mus musculus ] |
Official Symbol | Il13 |
Synonyms | IL13; interleukin 13; interleukin-13; T-cell activation protein P600; Il-13; |
Gene ID | 16163 |
mRNA Refseq | NM_008355 |
Protein Refseq | NP_032381 |
UniProt ID | P20109 |
◆ Recombinant Proteins | ||
Il13-49M | Active Recombinant Mouse Il13 Protein (Pro22-Fhe131), C-His tagged, Animal-free, Carrier-free | +Inquiry |
IL13-50H | Active Recombinant Human Interleukin 13, MIgG2a Fc-tagged | +Inquiry |
Il13-038I | Active Recombinant Mouse Il13 Protein (111 aa) | +Inquiry |
Il13-629M | Recombinant Mouse Il13 protein | +Inquiry |
IL-13-3015H | Recombinant Human IL-13 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL13-1894CCL | Recombinant Cynomolgus IL13 cell lysate | +Inquiry |
IL13-001HCL | Recombinant Human IL13 cell lysate | +Inquiry |
IL13-1336MCL | Recombinant Mouse IL13 cell lysate | +Inquiry |
IL13-2922HCL | Recombinant Human IL13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il13 Products
Required fields are marked with *
My Review for All Il13 Products
Required fields are marked with *