Recombinant Mouse IL17F Protein
| Cat.No. : | IL17F-144M | 
| Product Overview : | Recombinant Mouse IL17F Protein without tag was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse | 
| Source : | E.coli | 
| Description : | Interleukin 17F (IL-17F), a member of the IL-17 cytokine family, is secreted by activated CD4+ T cells and monocytes. | 
| Bio-activity : | No biological activity data is available at this time. | 
| AA Sequence : | MRKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA | 
| Endotoxin : | ≤1 EUs/μg, Kinetic LAL | 
| Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE | 
| Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. | 
| Storage : | Storage Prior to Reconstitution: | 
| Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) | 
| Reconstitution : | Sterile water at 0.1 mg/mL | 
| Shipping : | Room temperature | 
| Gene Name | Il17f interleukin 17F [ Mus musculus (house mouse) ] | 
| Official Symbol | IL17F | 
| Synonyms | IL17F; interleukin 17F; interleukin-17F; C87042; IL-17F; | 
| Gene ID | 257630 | 
| mRNA Refseq | NM_145856 | 
| Protein Refseq | NP_665855 | 
| UniProt ID | Q7TN17 | 
| ◆ Recombinant Proteins | ||
| IL17F-099I | Active Recombinant Human IL17F Protein (133 aa) | +Inquiry | 
| IL17F-964H | Recombinant Human IL17F protein, His-Avi-tagged | +Inquiry | 
| IL17F-6030C | Recombinant Chicken IL17F | +Inquiry | 
| IL17F-36H | Recombinant Human IL17F protein | +Inquiry | 
| IL17F-01H | Recombinant Human IL17F Protein, His-Tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| IL17F-2045HCL | Recombinant Human IL17F cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL17F Products
Required fields are marked with *
My Review for All IL17F Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            