Active Recombinant Mouse Il19 Protein, His-Tagged
Cat.No. : | Il19-01M |
Product Overview : | Recombinant mouse Il19 Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Interleukin 19 (IL-19) is a protein that in humans is encoded by the IL19 gene. This cytokine is found to be preferentially expressed in monocytes. It can bind the interleukin-20 receptor complex and lead to the activation of the signal transducer and activator of transcription 3 (STAT3). A similar cytokine in mouse is reported to up-regulate the expression of IL6 and TNF-alpha and induce apoptosis, which suggests a role of this cytokine in inflammatory responses. Alternatively, spliced transcript variants encoding the distinct isoforms have been described. |
Form : | Lyophilized powder |
AA Sequence : | MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLE RCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Bio-activity : | Measure by its ability to induce proliferation in BaF3 cells transfected with human IL-20 R alpha and human IL-20 R beta. The ED50 for this effect is <0.6 ng/mL. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : | Please use within one month after protein reconstitution. |
Gene Name | Il19 interleukin 19 [ Mus musculus (house mouse) ] |
Official Symbol | Il19 |
Gene ID | 329244 |
mRNA Refseq | NM_001009940.2 |
Protein Refseq | NP_001009940.1 |
UniProt ID | Q8CJ70 |
◆ Recombinant Proteins | ||
Il19-1668R | Recombinant Rat Il19 Protein, His-tagged | +Inquiry |
IL19-1470H | Recombinant Human IL19 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
IL19-499H | Active Recombinant Human Interleukin 19 | +Inquiry |
IL19-146H | Recombinant Human IL19 Protein | +Inquiry |
IL19-4228H | Recombinant Human IL19 Protein (Met1-Ala177), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL19-5242HCL | Recombinant Human IL19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il19 Products
Required fields are marked with *
My Review for All Il19 Products
Required fields are marked with *
0
Inquiry Basket