Active Recombinant Mouse Il1rn Protein, His-Tagged

Cat.No. : Il1rn-01M
Product Overview : Recombinant mouse Il1rn Protein, His-tagged was expressed in E. coli cell
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : The interleukin-1 receptor antagonist (IL-1RA) is a protein that in humans is encoded by the IL1RN gene. IL-1RA was initially called the IL-1 inhibitor and was discovered separately in 1984 by two independent laboratories. IL-1RA is an agent that binds non-productively to the cell surface interleukin-1 receptor (IL-1R), the same receptor that binds interleukin 1 (IL-1), preventing IL-1 from sending a signal to that cell.
Form : Lyophilized powder
AA Sequence : MRPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNK
EEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ with polyhistidine tag at the C-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Bio-activity : Measure by its ability to inhibit IL-1 alpha-dependent proliferation in D10.G4.1 cells. The ED50 for this effect is < 50 ng/mL.
Purity : >98% as determined by SDS-PAGE. Ni-NTA chromatography
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Notes : Please use within one month after protein reconstitution.
Gene Name Il1rn interleukin 1 receptor antagonist [ Mus musculus (house mouse) ]
Official Symbol Il1rn
Synonyms IL-1ra; F630041P17Rik
Gene ID 16181
mRNA Refseq NM_001039701.3
Protein Refseq NP_001034790.1
UniProt ID P25085

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il1rn Products

Required fields are marked with *

My Review for All Il1rn Products

Required fields are marked with *

0
cart-icon
0
compare icon