Recombinant Human IL1RN Protein
Cat.No. : | IL1RN-055H |
Product Overview : | Recombinant human IL1RN protein |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Protein Length : | 177 |
Description : | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses, particularly in the acute phase of infection and inflammation. This gene and five other closely related cytokine genes form a gene cluster spanning approximately 400 kb on chromosome 2. A polymorphism of this gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer. Several alternatively spliced transcript variants encoding distinct isoforms have been reported. |
Form : | Lyophilized |
AA Sequence : | MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | -18°C |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered and lyophilized. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | IL1RN interleukin 1 receptor antagonist [ Homo sapiens (human) ] |
Official Symbol | IL1RN |
Synonyms | IL1RN; interleukin 1 receptor antagonist; interleukin-1 receptor antagonist protein; ICIL 1RA; IL 1RN; IL1F3; IL1RA; interleukin 1 receptor antagonist protein; intracellular interleukin 1 receptor antagonist; IRAP; MGC10430; IL1 inhibitor; IL1RN (IL1F3); type II interleukin-1 receptor antagonist; intracellular IL-1 receptor antagonist type II; intracellular interleukin-1 receptor antagonist (icIL-1ra); DIRA; MVCD4; IL-1RN; IL-1ra; IL-1ra3; ICIL-1RA; |
Gene ID | 3557 |
mRNA Refseq | NM_000577 |
Protein Refseq | NP_000568 |
MIM | 147679 |
UniProt ID | P18510 |
◆ Recombinant Proteins | ||
IL1RN-4645C | Recombinant Chicken IL1RN | +Inquiry |
IL1RN-05H | Recombinant Human IL1RN protein | +Inquiry |
IL1RN-362C | Recombinant Cynomolgus Monkey IL1RN Protein, His (Fc)-Avi-tagged | +Inquiry |
IL1RN-2468H | Recombinant Human IL1RN Protein (Arg26-Glu177), His tagged | +Inquiry |
IL1RN-51H | Recombinant Human Interleukin 1 Receptor Antagonist, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1RN-1375RCL | Recombinant Rat IL1RN cell lysate | +Inquiry |
IL1RN-2912HCL | Recombinant Human IL1RN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL1RN Products
Required fields are marked with *
My Review for All IL1RN Products
Required fields are marked with *