Active Recombinant Mouse Il3 Protein, His-Tagged

• Cat.No.: Il3-01M
• Product Overview: Recombinant mouse Il3 Protein, His-tagged was expressed in E. coli cell

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: Interleukin 3 is an interleukin, a type of biological signal (cytokine) that can improve the body's natural response to disease as part of the immune system. It acts by binding to the interleukin-3 receptor. Interleukin 3 stimulates the differentiation of multipotent hematopoietic stem cells into myeloid progenitor cells or, with the addition of IL-7, into lymphoid progenitor cells. In addition, IL-3 stimulates proliferation of all cells in the myeloid lineage (granulocytes, monocytes, and dendritic cells), in conjunction with other cytokines, e.g., Erythropoietin (EPO), Granulocyte macrophage colony-stimulating factor (GM-CSF), and IL-6. It is secreted by basophils and activated T cells to support growth and differentiation of T cells from the bone marrow in an immune response.
• Form: Lyophilized powder
• AA Sequence: MDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDD
  FRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC with polyhistidine tag at the C-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Bio-activity: Measure by its ability to induce NFS-60 cells proliferation. The ED50 for this effect is <85 pg/mL. The specific activity of recombinant mouse IL-3 is approximately >1x 10^7 IU/mg.
• Purity: ≥95% as determined by SDS-PAGE and HPLC.
  Purified by Ni-NTA chromatography.
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Notes: Please use within one month after protein reconstitution.

Gene Information

• Gene Name: Il3 interleukin 3 [ Mus musculus (house mouse) ]
• Official Symbol: Il3
• Synonyms: BPA; PSF; HCGF; Il-3; MCGF; Csfmu
• Gene ID: 16187
• mRNA Refseq: NM_010556.4
• Protein Refseq: NP_034686.2
• UniProt ID: P01586