Active Recombinant Mouse Il3 Protein, His-Tagged

Cat.No. : Il3-01M
Product Overview : Recombinant mouse Il3 Protein, His-tagged was expressed in E. coli cell
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : Interleukin 3 is an interleukin, a type of biological signal (cytokine) that can improve the body's natural response to disease as part of the immune system. It acts by binding to the interleukin-3 receptor. Interleukin 3 stimulates the differentiation of multipotent hematopoietic stem cells into myeloid progenitor cells or, with the addition of IL-7, into lymphoid progenitor cells. In addition, IL-3 stimulates proliferation of all cells in the myeloid lineage (granulocytes, monocytes, and dendritic cells), in conjunction with other cytokines, e.g., Erythropoietin (EPO), Granulocyte macrophage colony-stimulating factor (GM-CSF), and IL-6. It is secreted by basophils and activated T cells to support growth and differentiation of T cells from the bone marrow in an immune response.
Form : Lyophilized powder
AA Sequence : MDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDD
FRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC with polyhistidine tag at the C-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Bio-activity : Measure by its ability to induce NFS-60 cells proliferation. The ED50 for this effect is <85 pg/mL. The specific activity of recombinant mouse IL-3 is approximately >1x 10^7 IU/mg.
Purity : ≥95% as determined by SDS-PAGE and HPLC.
Purified by Ni-NTA chromatography.
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Notes : Please use within one month after protein reconstitution.
Gene Name Il3 interleukin 3 [ Mus musculus (house mouse) ]
Official Symbol Il3
Synonyms BPA; PSF; HCGF; Il-3; MCGF; Csfmu
Gene ID 16187
mRNA Refseq NM_010556.4
Protein Refseq NP_034686.2
UniProt ID P01586

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il3 Products

Required fields are marked with *

My Review for All Il3 Products

Required fields are marked with *

0
cart-icon
0
compare icon