Active Recombinant Mouse Il3 Protein, His-Tagged
Cat.No. : | Il3-01M |
Product Overview : | Recombinant mouse Il3 Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Interleukin 3 is an interleukin, a type of biological signal (cytokine) that can improve the body's natural response to disease as part of the immune system. It acts by binding to the interleukin-3 receptor. Interleukin 3 stimulates the differentiation of multipotent hematopoietic stem cells into myeloid progenitor cells or, with the addition of IL-7, into lymphoid progenitor cells. In addition, IL-3 stimulates proliferation of all cells in the myeloid lineage (granulocytes, monocytes, and dendritic cells), in conjunction with other cytokines, e.g., Erythropoietin (EPO), Granulocyte macrophage colony-stimulating factor (GM-CSF), and IL-6. It is secreted by basophils and activated T cells to support growth and differentiation of T cells from the bone marrow in an immune response. |
Form : | Lyophilized powder |
AA Sequence : | MDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDD FRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Bio-activity : | Measure by its ability to induce NFS-60 cells proliferation. The ED50 for this effect is <85 pg/mL. The specific activity of recombinant mouse IL-3 is approximately >1x 10^7 IU/mg. |
Purity : | ≥95% as determined by SDS-PAGE and HPLC. Purified by Ni-NTA chromatography. |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : | Please use within one month after protein reconstitution. |
Gene Name | Il3 interleukin 3 [ Mus musculus (house mouse) ] |
Official Symbol | Il3 |
Synonyms | BPA; PSF; HCGF; Il-3; MCGF; Csfmu |
Gene ID | 16187 |
mRNA Refseq | NM_010556.4 |
Protein Refseq | NP_034686.2 |
UniProt ID | P01586 |
◆ Recombinant Proteins | ||
Il3-107M | Active Recombinant Mouse Il3 Protein | +Inquiry |
IL3-07H | Active Recombinant Human IL3 Protein, Pre-aliquoted | +Inquiry |
IL3-407D | Recombinant Canine IL3 protein | +Inquiry |
IL3-378H | Recombinant Human IL3, His tagged | +Inquiry |
ll3-542M | Recombinant Mouse Iterleukin 3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL3-607HCL | Recombinant Human IL3 cell lysate | +Inquiry |
IL3-445RCL | Recombinant Rat IL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il3 Products
Required fields are marked with *
My Review for All Il3 Products
Required fields are marked with *
0
Inquiry Basket