Recombinant Mouse Il36g Protein
| Cat.No. : | Il36g-176M | 
| Product Overview : | Recombinant Mouse Il36g Protein without tag was expressed in E. coli. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Mouse | 
| Source : | E.coli | 
| Description : | Interleukin 36 gamma (IL-36 £) is a member of the interleukin 1 (IL-1) cytokine family and protects against pathogens in the skin, lung, and stomach epithelial barriers. IL-36 £ binds the interleukin-1 receptor accessory protein (IL-1RAcP) and the orphan IL-1R-related protein 2 (IL-1Rrp2) receptors to activate NF-kB and MAP kinase signaling pathways, resulting in the induced production of inflammatory cytokines and chemokines. | 
| Bio-activity : | No biological activity data is available at this time. | 
| Molecular Mass : | Monomer, 17.5 kDa (153 aa) | 
| AA Sequence : | MGRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS | 
| Endotoxin : | ≤1 EUs/μg, Kinetic LAL | 
| Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE | 
| Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed.  | 
                                
| Storage : | Storage Prior to Reconstitution: -20 centigrade | 
| Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) | 
| Reconstitution : | Sterile 10 mM sterile HCl at 0.1 mg/mL | 
| Shipping : | Room temperature | 
| Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. | 
| Gene Name | Il36g interleukin 36G [ Mus musculus (house mouse) ] | 
| Official Symbol | Il36g | 
| Synonyms | Il36g; interleukin 36G; If36g; Il1f9; IL-36gamma; interleukin-36 gamma; IL-1F9; interleukin 1 family, member 9 | 
| Gene ID | 215257 | 
| mRNA Refseq | NM_153511 | 
| Protein Refseq | NP_705731 | 
| UniProt ID | Q8R460 | 
| ◆ Recombinant Proteins | ||
| IL36G-3654H | Recombinant Human IL36G protein, His-tagged | +Inquiry | 
| IL36G-7516H | Recombinant Human IL36G protein, His-tagged | +Inquiry | 
| Il1f9-648M | Recombinant Mouse Il1f9 protein | +Inquiry | 
| IL36G-511H | Recombinant Human IL36G protein | +Inquiry | 
| IL36G-7270H | Recombinant Human IL36G, None tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| IL36G-5235HCL | Recombinant Human IL1F9 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All Il36g Products
Required fields are marked with *
My Review for All Il36g Products
Required fields are marked with *
  
        
    
      
            