| Species : |
Mouse |
| Source : |
E.coli |
| Tag : |
His |
| Description : |
The expression of IL-36γ is high in psoriatic plaques and in tissues including epithelial cells. Signaling of IL-36γ through the IL-1Rrp2 receptor, which is mainly expressed on certain dendritic cells. The interaction between the IL-36 ligands and IL-1Rrp2 receptor trigger dendritic cell maturation and activation. IL-36γ also work as an agonist of NF-κB, consequently, stimulate the inflammatory response in bronchial epithelial cells. |
| Form : |
Lyophilized powder |
| AA Sequence : |
MGRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHP
EPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS with polyhistidine tag at the C-terminus |
| Endotoxin : |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Bio-activity : |
Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is <15 ng/mL. The specific activity of recombinant mouse IL-36 gamma is > 6 x 10^4 IU/mg. |
| Purity : |
>98% as determined by SDS-PAGE. Ni-NTA chromatography |
| Storage Buffer : |
The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
| Reconstitution : |
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
| Storage : |
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
| Notes : |
Please use within one month after protein reconstitution. |
