Active Recombinant Mouse Il36g Protein, His-Tagged

• Cat.No.: Il36g-01M
• Product Overview: Recombinant mouse Il36g Protein, His-tagged was expressed in E. coli cell

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: The expression of IL-36γ is high in psoriatic plaques and in tissues including epithelial cells. Signaling of IL-36γ through the IL-1Rrp2 receptor, which is mainly expressed on certain dendritic cells. The interaction between the IL-36 ligands and IL-1Rrp2 receptor trigger dendritic cell maturation and activation. IL-36γ also work as an agonist of NF-κB, consequently, stimulate the inflammatory response in bronchial epithelial cells.
• Form: Lyophilized powder
• AA Sequence: MGRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHP
  EPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS with polyhistidine tag at the C-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Bio-activity: Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is <15 ng/mL. The specific activity of recombinant mouse IL-36 gamma is > 6 x 10^4 IU/mg.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Notes: Please use within one month after protein reconstitution.

Gene Information

• Gene Name: Il36g interleukin 36G [ Mus musculus (house mouse) ]
• Official Symbol: Il36g
• Synonyms: If36g; Il1f9; IL-36gamma
• Gene ID: 215257
• mRNA Refseq: NM_153511.3
• Protein Refseq: NP_705731.2
• UniProt ID: Q3U0P4