Active Recombinant Mouse Il36g Protein, His-Tagged

Cat.No. : Il36g-01M
Product Overview : Recombinant mouse Il36g Protein, His-tagged was expressed in E. coli cell
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : The expression of IL-36γ is high in psoriatic plaques and in tissues including epithelial cells. Signaling of IL-36γ through the IL-1Rrp2 receptor, which is mainly expressed on certain dendritic cells. The interaction between the IL-36 ligands and IL-1Rrp2 receptor trigger dendritic cell maturation and activation. IL-36γ also work as an agonist of NF-κB, consequently, stimulate the inflammatory response in bronchial epithelial cells.
Form : Lyophilized powder
AA Sequence : MGRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHP
EPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS with polyhistidine tag at the C-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Bio-activity : Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is <15 ng/mL. The specific activity of recombinant mouse IL-36 gamma is > 6 x 10^4 IU/mg.
Purity : >98% as determined by SDS-PAGE. Ni-NTA chromatography
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Notes : Please use within one month after protein reconstitution.
Gene Name Il36g interleukin 36G [ Mus musculus (house mouse) ]
Official Symbol Il36g
Synonyms If36g; Il1f9; IL-36gamma
Gene ID 215257
mRNA Refseq NM_153511.3
Protein Refseq NP_705731.2
UniProt ID Q3U0P4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il36g Products

Required fields are marked with *

My Review for All Il36g Products

Required fields are marked with *

0
cart-icon
0
compare icon