Active Recombinant Mouse Il9 Protein, His-Tagged
Cat.No. : | Il9-01M |
Product Overview : | Recombinant mouse Il9 Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Interleukin 9, also known as IL-9, is a pleiotropic cytokine (cell signalling molecule) belonging to the group of interleukins. IL-9 is produced by variety of cells like mast cells, NKT cells, Th2, Th17, Treg, ILC2, and Th9 cells in different amounts. Among them, Th9 cells are regarded as the major CD4+ T cells that produce IL-9. |
Form : | Lyophilized powder |
AA Sequence : | QRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPC NQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP with polyhistidine tag at the N-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Bio-activity : | Measure by its ability to induce proliferation in MO7e cells. The ED50 for this effect is <0.2 ng/mL. The specific activity of recombinant mouse IL-9 is > 5 x 10^6 IU/mg. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : | Please use within one month after protein reconstitution. |
Gene Name | Il9 interleukin 9 [ Mus musculus (house mouse) ] |
Official Symbol | Il9 |
Synonyms | P40; Il-9 |
Gene ID | 16198 |
mRNA Refseq | NM_008373.2 |
Protein Refseq | NP_032399.1 |
UniProt ID | P15247 |
◆ Recombinant Proteins | ||
Il9-01M | Active Recombinant Mouse Il9 Protein, His-Tagged | +Inquiry |
IL9-218H | Recombinant Active Human IL9 Protein, His-tagged(N-ter) | +Inquiry |
IL9-0312H | Recombinant Human IL9 protein, His-tagged | +Inquiry |
IL9-8181M | Recombinant Mouse IL9 Protein | +Inquiry |
Il9-1060R | Recombinant Rat Il9 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL9-618HCL | Recombinant Human IL9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il9 Products
Required fields are marked with *
My Review for All Il9 Products
Required fields are marked with *
0
Inquiry Basket