| Species : |
Mouse |
| Source : |
E.coli |
| Tag : |
His |
| Description : |
Interleukin 9, also known as IL-9, is a pleiotropic cytokine (cell signalling molecule) belonging to the group of interleukins. IL-9 is produced by variety of cells like mast cells, NKT cells, Th2, Th17, Treg, ILC2, and Th9 cells in different amounts. Among them, Th9 cells are regarded as the major CD4+ T cells that produce IL-9. |
| Form : |
Lyophilized powder |
| AA Sequence : |
QRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPC NQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP with polyhistidine tag at the N-terminus |
| Endotoxin : |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Bio-activity : |
Measure by its ability to induce proliferation in MO7e cells. The ED50 for this effect is <0.2 ng/mL. The specific activity of recombinant mouse IL-9 is > 5 x 10^6 IU/mg. |
| Purity : |
>98% as determined by SDS-PAGE. Ni-NTA chromatography |
| Storage Buffer : |
The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
| Reconstitution : |
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
| Storage : |
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
| Notes : |
Please use within one month after protein reconstitution. |