Active Recombinant Mouse Lif, Fc-tagged, Biotinylated

Cat.No. : Lif-720M
Product Overview : The recombinant mouse LIF-Fc fusion protein is expressed as a 419-amino acid protein consisting of Ser24 - Phe203 region of (UniProt accession #P09056) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Human Cells
Tag : Fc
Protein Length : 24-203 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Stimulates TF-1 human erythroleukemic cell proliferation assay with an ED50 typically 0.4 - 1 ng/ml. Induce IL-6 secretion in M1 mouse myeloid leukemia cells. Supports the maintenance of embryonic stem (ES) cell pluripotency and germline competency.
Molecular Mass : Calculated molecular mass (kDa): 46.6; Estimated by SDS-PAGE under reducing condition (kDa): 60-65
AA Sequence : SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGT EKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPD HSDKEAFQRKKLGCQLLGTYKQVISVVVQAFGSTTENLYFQGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTL MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN KALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
Purity : >90% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name Lif leukemia inhibitory factor [ Mus musculus ]
Official Symbol Lif
Synonyms LIF; leukemia inhibitory factor; d factor; differentiation-stimulating factor;
Gene ID 16878
mRNA Refseq NM_001039537
Protein Refseq NP_001034626
MIM
UniProt ID
Pathway Adipogenesis, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; ESC Pluripotency Pathways, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; MicroRNAs in cardiomyocyte hypertrophy, organism-specific biosystem;
Function cytokine activity; cytokine activity; growth factor activity; growth factor activity; leukemia inhibitory factor receptor binding; receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Lif Products

Required fields are marked with *

My Review for All Lif Products

Required fields are marked with *

0
cart-icon