Active Recombinant Mouse Mdk Protein

Cat.No. : Mdk-124M
Product Overview : Purified recombinant protein of Mouse midkine (Mdk), transcript variant 1 without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : This gene encodes a secreted growth factor that belongs to the pleiotrophin/midkine heparin-binding protein family and functions in a variety of biological processes. The encoded cytokine promotes the growth, differentiation, survival and migration of several target cells including leucocytes involved in inflammation. This protein plays a role in the formation of scar tissue and intraperitoneal adhesions, and promotes neurite outgrowth and neuron survival. The protein encoded by this gene is associated with obesity and inhibition of insulin signaling in fat cells. A pseudogene of this gene is present on chromosome 11. Alternative splicing results in multiple transcript variants.
Bio-activity : Determined by its ability to chemoattract human neutrophils using a concentration range of 10-100 ng/ml.Cell treatment (PMID: 28489825)
Molecular Mass : 13.3 kDa
AA Sequence : VAKKKEKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKTKAKKGKGKD
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Mdk midkine [ Mus musculus (house mouse) ]
Official Symbol Mdk
Synonyms Mdk; midkine; MK; Mek; midkine; retanoic acid-responsive protein; retinoic acid-induced differentiation factor; retinoic acid-responsive protein
Gene ID 17242
mRNA Refseq NM_010784
Protein Refseq NP_034914
UniProt ID P12025

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Mdk Products

Required fields are marked with *

My Review for All Mdk Products

Required fields are marked with *

0

Inquiry Basket

cartIcon