Recombinant Human MDK Protein, GST-tagged

Cat.No. : MDK-4496H
Product Overview : Human MDK full-length ORF ( AAH11704, 1 a.a. - 143 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of a small family of secreted growth factors that binds heparin and responds to retinoic acid. The encoded protein promotes cell growth, migration, and angiogenesis, in particular during tumorigenesis. This gene has been targeted as a therapeutic for a variety of different disorders. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Jul 2012]
Molecular Mass : 41.47 kDa
AA Sequence : MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCAPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MDK midkine (neurite growth-promoting factor 2) [ Homo sapiens ]
Official Symbol MDK
Synonyms MDK; midkine (neurite growth-promoting factor 2); NEGF2; midkine; FLJ27379; MK; ARAP; amphiregulin-associated protein; midgestation and kidney protein; neurite outgrowth-promoting protein; neurite outgrowth-promoting factor 2;
Gene ID 4192
mRNA Refseq NM_001012333
Protein Refseq NP_001012333
MIM 162096
UniProt ID P21741

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MDK Products

Required fields are marked with *

My Review for All MDK Products

Required fields are marked with *

0
cart-icon