Recombinant Human MDK Protein, GST-tagged
Cat.No. : | MDK-4496H |
Product Overview : | Human MDK full-length ORF ( AAH11704, 1 a.a. - 143 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of a small family of secreted growth factors that binds heparin and responds to retinoic acid. The encoded protein promotes cell growth, migration, and angiogenesis, in particular during tumorigenesis. This gene has been targeted as a therapeutic for a variety of different disorders. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Jul 2012] |
Molecular Mass : | 41.47 kDa |
AA Sequence : | MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCAPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MDK midkine (neurite growth-promoting factor 2) [ Homo sapiens ] |
Official Symbol | MDK |
Synonyms | MDK; midkine (neurite growth-promoting factor 2); NEGF2; midkine; FLJ27379; MK; ARAP; amphiregulin-associated protein; midgestation and kidney protein; neurite outgrowth-promoting protein; neurite outgrowth-promoting factor 2; |
Gene ID | 4192 |
mRNA Refseq | NM_001012333 |
Protein Refseq | NP_001012333 |
MIM | 162096 |
UniProt ID | P21741 |
◆ Recombinant Proteins | ||
MDK-1386H | Recombinant Human MDK Protein, His (Fc)-Avi-tagged | +Inquiry |
MDK-11H | Recombinant Human Midkine Protein, His/S-tagged | +Inquiry |
MDK-6105HF | Recombinant Full Length Human MDK Protein, GST-tagged | +Inquiry |
MDK-4526H | Recombinant Human MDK Protein (Ala22-Asp143), His tagged | +Inquiry |
Mdk-637R | Recombinant Rat Mdk protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MDK-568HCL | Recombinant Human MDK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MDK Products
Required fields are marked with *
My Review for All MDK Products
Required fields are marked with *