Active Recombinant Mouse Vegfa Protein
Cat.No. : | Vegfa-7371M |
Product Overview : | Recombinant Murine Vascular Endothelial Growth Factor188 without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | This gene is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Disruption of this gene in mice resulted in abnormal embryonic blood vessel formation. This gene is upregulated in many known tumors and its expression is correlated with tumor stage and progression. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. There is also evidence for alternative translation initiation from upstream non-AUG (CUG) codons resulting in additional isoforms. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is antiangiogenic. Expression of some isoforms derived from the AUG start codon is regulated by a small upstream open reading frame, which is located within an internal ribosome entry site. |
Form : | Lyophilized |
Bio-activity : | Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 2-20 ng/mL. |
Molecular Mass : | 44.2 kDa |
AA Sequence : | APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKKKSRFKSWSVHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
N-terminal Sequence Analysis : | APTTEGE |
Endotoxin : | < 0.1 ng/μg of VEGF188 |
Purity : | > 95 % by SDS-PAGE and Silver staining |
Stability : | Shelf life: one year from despatch. |
Storage : | Store lyophilized at 2-8 centigrade for 6 months or at -20 centigrade long term. After reconstitution store the antibody undiluted at 2-8 centigrade for one month or (in aliquots) at -20 centigrade long term. Avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Acetic Acid |
Reconstitution : | The lyophilized VEGF188 should be reconstituted in 50 mM Acetic Acid or medium containing at least 0.1 % Human or BSA to a concentration not lower than 50 μg/mL. |
Gene Name | Vegfa vascular endothelial growth factor A [ Mus musculus (house mouse) ] |
Official Symbol | Vegfa |
Synonyms | Vegfa; vascular endothelial growth factor A; V; Veg; Vpf; Vegf; VEGF12; VEGF16; VEGF18; vascular endothelial growth factor A; vascular permeability factor |
Gene ID | 22339 |
mRNA Refseq | NM_001025250 |
Protein Refseq | NP_001020421 |
UniProt ID | Q00731 |
◆ Recombinant Proteins | ||
Vegfa-878RAF647 | Recombinant Rat Vegfa Protein, None-tagged, Alexa Fluor 647 conjugated | +Inquiry |
Vegfa-38R | Active Recombinant Rat Vegfa protein, His-tagged, 27-190aa | +Inquiry |
VEGFA-309HAF488 | Recombinant Human VEGFA Protein, Alexa Fluor 488 conjugated | +Inquiry |
VEGFA-561H | Recombinant Human VEGFA Protein, His-tagged | +Inquiry |
VEGFA-711H | Active Recombinant Human VEGFA, Isoform 165, His-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
VEGFA-31701TH | Native Human VEGFA | +Inquiry |
◆ Cell & Tissue Lysates | ||
VEGFA-655HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
VEGFA-974HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
VEGFA-647MCL | Recombinant Mouse VEGFA cell lysate | +Inquiry |
VEGFA-522RCL | Recombinant Rat VEGFA cell lysate | +Inquiry |
VEGFA-969CCL | Recombinant Canine VEGFA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Vegfa Products
Required fields are marked with *
My Review for All Vegfa Products
Required fields are marked with *
0
Inquiry Basket