Species : |
Rat |
Source : |
CHO |
Description : |
Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) was initially characterized as a growth factor that can support the in vitro colony formation of granulocyte-macrophage progenitors. Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) is produced by a number of different cell types, including activated T cells, B cells, macrophages, mast cells, endothelial cells, and fibroblasts, in response to cytokine of immune and inflammatory stimuli. Besides granulocyte-macrophage progenitors, Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) is a growth factor for erythroid, megakaryocyte, and eosinophil progenitors. On mature hematopoietic, monocytes/macrophages and eosinophils. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
ED50 < 5 pg/mL, measured in a cell proliferation assay using FDC-P1 cells, corresponding to a specific activity of > 2 × 10^8 units/mg. |
Molecular Mass : |
16-26 kDa, observed by non-reducing SDS-PAGE. |
AA Sequence : |
APTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK |
Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
Purity : |
> 95% as analyzed by SDS-PAGE and HPLC. |
Storage : |
Lyophilized recombinant Rat Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rrGM-CSF should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
Reconstitution : |
Reconstituted in ddH2O or PBS at 100 μg/mL. |