Active Recombinant Rat Csf2 Protein

Cat.No. : Csf2-274C
Product Overview : Recombinant Rat Csf2 Protein without tag was expressed in CHO.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : CHO
Description : Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) was initially characterized as a growth factor that can support the in vitro colony formation of granulocyte-macrophage progenitors. Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) is produced by a number of different cell types, including activated T cells, B cells, macrophages, mast cells, endothelial cells, and fibroblasts, in response to cytokine of immune and inflammatory stimuli. Besides granulocyte-macrophage progenitors, Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) is a growth factor for erythroid, megakaryocyte, and eosinophil progenitors. On mature hematopoietic, monocytes/macrophages and eosinophils.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 5 pg/mL, measured in a cell proliferation assay using FDC-P1 cells, corresponding to a specific activity of > 2 × 10^8 units/mg.
Molecular Mass : 16-26 kDa, observed by non-reducing SDS-PAGE.
AA Sequence : APTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant Rat Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rrGM-CSF should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name Csf2 colony stimulating factor 2 (granulocyte-macrophage) [ Rattus norvegicus ]
Official Symbol Csf2
Synonyms CSF2; colony stimulating factor 2 (granulocyte-macrophage); granulocyte-macrophage colony-stimulating factor; CSF; colony-stimulating factor; Gmcsf; Gm-csf;
Gene ID 116630
mRNA Refseq NM_053852
Protein Refseq NP_446304
UniProt ID P48750

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Csf2 Products

Required fields are marked with *

My Review for All Csf2 Products

Required fields are marked with *

0
cart-icon
0
compare icon