Active Recombinant Rat Cxcl2 Protein (73 aa)
Cat.No. : | Cxcl2-386C |
Product Overview : | Recombinant Rat Cxcl2 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Protein Length : | 73 |
Description : | Rat CXCL2 also named CINC-3, is belonging to the CXC chemokine family. It is encoded by the gene CXCL2. CXCL2 shares 90% amino acid sequence with CXCL1/GROα. CINC-3 is member of the intercrine alpha (chemokine C-X-C) subfamily of chemokines. This chemokine is expressed by cytokine-stimulated rat alveolar macrophages and fibroblasts. The functional receptor for CXCL2 has been identified as CXCR2. CXCL2 is chemotactic for polymorphonuclear leukocytes and hematopoietic stem cells. Similar to other GRO proteins, CXCL2 is potent neutrophil attractants and activators. In addition, it is also active toward basophils. The amino acid sequence of rat CXCL2 is 88% identical to murine CXCL2. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. Determined by its ability to chemoattract total human neutrophils using a concentration range of 1.0-10.0 ng/mL. |
Molecular Mass : | Approximately 7.9 kDa, a single, non-glycosylated polypeptide chain containing 73 amino acids. |
AA Sequence : | VVVASELRCQCLTTLPRVDFKNIQSLTVTPPGPHCAQTEVIATLKDGHEVCLNPEAPLVQRIVQKILNKGKAN |
Endotoxin : | Less than 1 EU/μg of rRtMIP-2/CXCL2 as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Cxcl2 chemokine (C-X-C motif) ligand 2 [ Rattus norvegicus ] |
Official Symbol | Cxcl2 |
Synonyms | CXCL2; chemokine (C-X-C motif) ligand 2; C-X-C motif chemokine 2; MIP2; CINC-3; macrophage inflammatory protein 2; small inducible cytokine subfamily, member 2; cytokine-induced neutrophil chemoattractant 3; Mip-2; Scyb2; |
Gene ID | 114105 |
mRNA Refseq | NM_053647 |
Protein Refseq | NP_446099 |
UniProt ID | P30348 |
◆ Recombinant Proteins | ||
Cxcl2-020C | Active Recombinant Mouse Cxcl2 Protein (73 aa) | +Inquiry |
CXCL2-885H | Recombinant Horse CXCL2 Protein, His-tagged | +Inquiry |
CXCL2-282H | Recombinant Human CXCL2, StrepII-tagged | +Inquiry |
Cxcl2-78M | Active Recombinant Mouse Cxcl2 Protein (Ala28-Asn110), N-His tagged, Animal-free, Carrier-free | +Inquiry |
Cxcl2-010C | Active Recombinant Rat Cxcl2 Protein (73 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL2-7168HCL | Recombinant Human CXCL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cxcl2 Products
Required fields are marked with *
My Review for All Cxcl2 Products
Required fields are marked with *
0
Inquiry Basket